Property Summary

NCBI Gene PubMed Count 18
PubMed Score 23.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Clostridium difficile colitis 12 3.741 1.9
Kabuki syndrome 29 3.113 1.6

Expression

  Differential Expression (23)

Disease log2 FC p
posterior fossa group B ependymoma -3.400 2.9e-11
osteosarcoma 2.992 2.1e-03
glioblastoma -2.900 7.0e-04
group 4 medulloblastoma -3.400 1.1e-07
atypical teratoid / rhabdoid tumor -3.600 2.3e-06
medulloblastoma, large-cell -1.300 1.9e-02
primitive neuroectodermal tumor -1.700 1.5e-02
non-small cell lung cancer -2.082 8.2e-16
intraductal papillary-mucinous adenoma (... -3.700 4.4e-05
intraductal papillary-mucinous carcinoma... -3.700 6.6e-05
intraductal papillary-mucinous neoplasm ... -3.200 1.3e-03
lung cancer -1.800 3.2e-03
sarcoidosis 1.100 1.5e-02
lung adenocarcinoma -1.600 2.3e-09
pediatric high grade glioma -1.900 1.0e-02
non primary Sjogren syndrome sicca -1.100 2.2e-02
acute myeloid leukemia -1.300 8.4e-03
psoriasis -1.300 1.0e-16
lung carcinoma -1.100 1.2e-09
Pick disease 1.500 1.9e-02
Breast cancer 1.900 1.3e-04
gastric carcinoma 1.200 2.1e-02
ovarian cancer 1.100 1.7e-02

Protein-protein Interaction (6)

Gene RIF (9)

PMID Text
24669844 The data support a novel regulatory mechanism whereby sGC activity is tuned by distinct domain interactions that either promote or inhibit catalytic activity.
24666322 HIV-1 Tat potentiates NMDA-evoked (Ca2+)I responses involve LRP and a Src family kinase via the NOS/sGC/PKG pathway
22426988 The CO binding affinity of soluble guanylate cyclase alpha 2 subunit is threefold greater than that of human soluble guanylate cyclase alpha 1 subunit.
20978832 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19948239 The sGC alpha 1observed in OVCAR-3 and MDA-MB-468 cancer cells which correlated well with the sGC activity and a marked increase in cGMP levels upon exposure to the combination of a NO donor and a sGC activator.
19240061 Observational study of gene-disease association. (HuGE Navigator)
15094474 No significant changes were found in sGC subunit mRNAs in people with schizophrenia or in controls.
11752394 Soluble guanylyl cyclase (sGC) is the major cellular receptor for the intercellular messenger nitric oxide (NO) and mediates a wide range of physiological effects through elevation of intracellular cGMP levels

AA Sequence

MSRRKISSESFSSLGSDYLETSPEEEGECPLSRLCWNGSRSPPGPLEPSPAAAAAAAAPAPTPAASAAAA      1 - 70
AATAGARRVQRRRRVNLDSLGESISRLTAPSPQTIQQTLKRTLQYYEHQVIGYRDAEKNFHNISNRCSYA     71 - 140
DHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEFFNICFHENERVLRAVGGTLQDFFNGFDALLEHI    141 - 210
RTSFGKQATLESPSFLCKELPEGTLMLHYFHPHHIVGFAMLGMIKAAGKKIYRLDVEVEQVANEKLCSDV    211 - 280
SNPGNCSCLTFLIKECENTNIMKNLPQGTSQVPADLRISINTFCRAFPFHLMFDPSMSVLQLGEGLRKQL    281 - 350
RCDTHKVLKFEDCFEIVSPKVNATFERVLLRLSTPFVIRTKPEASGSENKDKVMEVKGQMIHVPESNSIL    351 - 420
FLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQALEEEKKKT    421 - 490
VDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGFL    491 - 560
DIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMMELSEEVLTPDGRPIQMRIGIHSGSVLAGVVGVR    561 - 630
MPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLLKREESFTFIPRSREELPDNFPKEIPGICYFLEVR    631 - 700
TGPKPPKPSLSSSRIKKVSYNIGTMFLRETSL                                          701 - 732
//

Text Mined References (21)

PMID Year Title
25390645 2014 Genome-wide and gene-based association studies of anxiety disorders in European and African American samples.
24669844 2014 Interfacial residues promote an optimal alignment of the catalytic center in human soluble guanylate cyclase: heterodimerization is required but not sufficient for activity.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22426988 2012 Structural and functional insights into the heme-binding domain of the human soluble guanylate cyclase ?2 subunit and heterodimeric ?2?1.
20978832 2011 Gene-environment interaction in the etiology of mathematical ability using SNP sets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19948239 2010 Role of soluble guanylyl cyclase-cyclic GMP signaling in tumor cell proliferation.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15094474 2004 Expression of nNOS and soluble guanylate cyclase in schizophrenic brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11572861 2001 Guanylyl cyclase/PSD-95 interaction: targeting of the nitric oxide-sensitive alpha2beta1 guanylyl cyclase to synaptic membranes.
11158065 2001 Expression and tissue localization of soluble guanylyl cyclase in the human placenta using novel antibodies directed against the alpha(2) subunit.
10512742 1999 Tissue distribution of the human soluble guanylate cyclases.
8660992 1996 Assignment of GUCIA2, the gene coding for the alpha 2 subunit of soluble guanylyl cyclase, to position 11q21-q22 on human chromosome 11.
7673142 1995 A variant of the alpha 2 subunit of soluble guanylyl cyclase contains an insert homologous to a region within adenylyl cyclases and functions as a dominant negative protein.
1683630 1991 Molecular cloning and expression of a new alpha-subunit of soluble guanylyl cyclase. Interchangeability of the alpha-subunits of the enzyme.