Property Summary

NCBI Gene PubMed Count 21
PubMed Score 20.20
PubTator Score 90.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (4)

PMID Text
18037771 Observational study of gene-disease association. (HuGE Navigator)
18037771 The occurrences of the C-A haplotype (rs883062-rs1047047) and the C-A-G haplotype (rs883062-rs1047047-rs2297566) were significantly higher in the essential hypertension group than in the controls.
17582287 Observational study of gene-disease association. (HuGE Navigator)
15780094 Uroguanylin concentrations are increased in patients with chronic renal failure, nephrotic syndrome, or those on dialysis.

AA Sequence

MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHP      1 - 70
ALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL                                 71 - 112
//

Text Mined References (21)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22877138 2012 The uroguanylin system and human disease.
18037771 2007 Haplotype-based case-control study of the association between the guanylate cyclase activator 2B (GUCA2B, Uroguanylin) gene and essential hypertension.
17582287 2007 [Association between uroguanylin G-247A polymorphism and blood pressure/fluid and electrolytes homeostasis].
15780094 2005 Guanylin and uroguanylin regulate electrolyte transport in isolated human cortical collecting ducts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12548407 2003 Occurrence and localization of uroguanylin in the aging human prostate.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11889121 2002 Guanylin, uroguanylin, and heat-stable euterotoxin activate guanylate cyclase C and/or a pertussis toxin-sensitive G protein in human proximal tubule cells.
11431160 2001 Uroguanylin and guanylate cyclase C in the human pancreas: expression and mutuality of ligand/receptor localization as indicators of intercellular paracrine signaling pathways.
11380922 2001 Uroguanylin level in umbilical cord blood.
9774236 1998 One peptide, two topologies: structure and interconversion dynamics of human uroguanylin isomers.
9698373 1998 The kinase homology domain of retinal guanylyl cyclases 1 and 2 specifies the affinity and cooperativity of interaction with guanylyl cyclase activating protein-2.
9622502 1998 In vitro disulfide-coupled folding of guanylyl cyclase-activating peptide and its precursor protein.
9328941 1997 Urine and plasma levels of uroguanylin and its molecular forms in renal diseases.
9268639 1997 Genomic structure and chromosomal localization of human uroguanylin.
8605041 1996 Cloning and characterization of a cDNA encoding a precursor for human uroguanylin.
8519795 1995 A new human guanylate cyclase-activating peptide (GCAP-II, uroguanylin): precursor cDNA and colonic expression.
8141334 1994 Characterization of human uroguanylin: a member of the guanylin peptide family.
7589507 1995 GCAP-II: isolation and characterization of the circulating form of human uroguanylin.