Property Summary

NCBI Gene PubMed Count 14
PubMed Score 205.21
PubTator Score 65.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 1.100 3.7e-04
osteosarcoma 2.292 9.5e-05
acute quadriplegic myopathy 1.058 1.0e-05
intraductal papillary-mucinous adenoma (... 1.600 1.8e-03
intraductal papillary-mucinous carcinoma... 1.600 9.1e-03
lung cancer 1.500 1.8e-03
colon cancer 1.400 5.5e-03
ovarian cancer 3.800 4.6e-07

AA Sequence

MDPPAVVAESVSSLTIADAFIAAGESSAPTPPRPALPRRFICSFPDCSANYSKAWKLDAHLCKHTGERPF      1 - 70
VCDYEGCGKAFIRDYHLSRHILTHTGEKPFVCAANGCDQKFNTKSNLKKHFERKHENQQKQYICSFEDCK     71 - 140
KTFKKHQQLKIHQCQHTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVR    141 - 210
ETHKEEILCEVCRKTFKRKDYLKQHMKTHAPERDVCRCPREGCGRTYTTVFNLQSHILSFHEESRPFVCE    211 - 280
HAGCGKTFAMKQSLTRHAVVHDPDKKKMKLKVKKSREKRSLASHLSGYIPPKRKQGQGLSLCQNGESPNC    281 - 350
VEDKMLSTVAVLTLG                                                           351 - 365
//

Text Mined References (16)

PMID Year Title
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12711686 2003 Assembly and isolation of intermediate steps of transcription complexes formed on the human 5S rRNA gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11814676 2002 cDNA cloning, DNA binding, and evolution of mammalian transcription factor IIIA.
10756201 2000 Identification of a transcription factor IIIA-interacting protein.
9171097 1997 Human transcription factors IIIC2 , IIIC1 and a novel component IIIC0 fulfil different aspects of DNA binding to various pol III genes.
8610146 1996 Amphibian transcription factor IIIA proteins contain a sequence element functionally equivalent to the nuclear export signal of human immunodeficiency virus type 1 Rev.
8063702 1994 Purification and characterization of human transcription factor IIIA.
7789179 1995 Molecular cloning, characterization, and chromosomal mapping of a novel human gene (GTF3A) that is highly homologous to Xenopus transcription factor IIIA.
7622052 1995 Cloning and expression analysis of a human cDNA homologous to Xenopus TFIIIA.
2912980 1989 Purification of human transcription factor IIIA and its interaction with a chemically synthesized gene encoding human 5 S rRNA.