Property Summary

NCBI Gene PubMed Count 55
PubMed Score 98.31
PubTator Score 95.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.006 1.3e-02

Gene RIF (43)

PMID Text
26970898 rs7975 GG carriers had an increased risk of below-reference sperm motility
25738370 We conclude that the lower expression of GSTZ1 in Whites who possess the K carrier haplotype results in lower enzymatic activity and slower metabolism of DCA, compared with those who possess the non-K carrier haplotype
25079374 Haplotype variations in glutathione transferase zeta 1 influence the kinetics and dynamics of chronic dichloroacetate in children
24719983 The data indicates no association between GSTZ1 genotypes and risk of gastric cancer.
23299908 Elucidation of the role of individual residues in the N-terminal, SSC motif of human GSTZ1.
23280616 The ping-pong catalytic mechanism of Se-hGSTZ1-1 is similar to that of the natural GPX.
22729907 The present results indicate that the haplotype of "-1002A, 32Lys, 42Arg" (containing three variant alleles) of GSTZ1 have protective effect compared to the other haplotypes.
22576335 Two SNPs, rs282070 located in intron 1 of the MAP3K7 gene, and rs2111699 located in intron 1 of the GSTZ1 gene, were significantly associated (after adjustment for multiple testing) with longevity in stage 2
22561244 e report for the first time the conversion of human glutathione transferase Zeta (hGSTZ1-1) into seleno-hGSTZ1-1 by means of genetic engineering in eukaryotes.
22374552 This study was performed on 228 BPD patients and 234 control subjects. Among early-onset patients, the variant alleles of Glu32Lys and G-1002A increased BPD susceptibility.
22082156 Knockdown of glutathione transferase zeta 1 (GSTZ1) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
22028318 Data suggest neonatal onset and age-related increase in GSTZ1 protein expression during liver development/growth. GSTZ1 haplotype influences activity with dichloroacetate but not protein expression.
21948024 Our study did not support any association between susceptibility to exudative AMD (age-related macular degeneration) and polymorphisms of GSTZ1.
21823988 polymorphisms of GSTZ1 showed strong linkage disequilibrium among cancer patients and control su
21183226 The results of this study did not support the association between genetic polymorphisms of glutathione S-transferase Z1 (GSTZ1) and susceptibility to schizophrenia.
21107728 Results describe the genotypic frequencies of glutathione S-transferase Z1 polymorphisms among an Iranian population.
20675267 subjects with polymorphisms in GSTZ1 have a higher trihalomethanes induced bladder cancer susceptibility
20675267 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20214911 our results did not reveal a consistent pattern between GSTM1 and GSTZ genotypes and increased occurrence of adverse sperm outcomes
20214911 Observational study of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20200426 Observational study of gene-disease association. (HuGE Navigator)
19859803 it is unlikely that glutathione S-transferases GSTA2, GSTM2, GSTO1, GSTO2, and GSTZ1 participate in breast cancer susceptibility.
19859803 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18776599 MDR analysis revealed a three-gene combination, consisting of NOS3 (p.Glu298Asp), GSTZ1 (p.Lys32Glu), and GSTP1 (p.Ile105Val), that provided the highest predictive model for gentamicin-induced vestibular dysfunction.
18776599 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18628685 The results are consistent with the hypothesis that reduced dopamine metabolism adversely affects cognition.
18373941 Kinetic studies revealed that the catalytic mechanism of Se-hGSTZ1-1 belong in a ping-pong mechanism similar to that of the natural glutathione peroxidase.
17601350 Observational study of gene-disease association. (HuGE Navigator)
17034008 Observational study of gene-disease association. (HuGE Navigator)
16609361 Single nucleotide polymorphisms may alter GSTZ1 expression, which may alter the pharmacokinetics of DCA, which is used therapeutically for the treatment of lactic acidosis.
15288444 Observational study of gene-environment interaction. (HuGE Navigator)
12485442 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11737895 Observational study of gene-disease association. (HuGE Navigator)
11692075 A new allele of GSTZ1 (maleylacetoacetate isomerase), characterized by a Thr82Met substitution and termed GSTZ1d, has been identified by analysis of the expressed sequence tag (EST) database.

AA Sequence

MQAGKPILYSYFRSSCSWRVRIALALKGIDYKTVPINLIKDRGQQFSKDFQALNPMKQVPTLKIDGITIH      1 - 70
QSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFN     71 - 140
ALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDT    141 - 210
PTELRA                                                                    211 - 216
//

Text Mined References (58)

PMID Year Title
26970898 2016 Interactions between CYP2E1, GSTZ1 and GSTT1 polymorphisms and exposure to drinking water trihalomethanes and their association with semen quality.
25738370 2015 The influence of human GSTZ1 gene haplotype variations on GSTZ1 expression.
25079374 2015 Haplotype variations in glutathione transferase zeta 1 influence the kinetics and dynamics of chronic dichloroacetate in children.
24719983 2014 Glutathione S-transferase Z1 (GSTZ1) gene polymorphism in gastric cancer: a preliminary study in a Turkish population.
23299908 2013 Characterization of catalytic activity and structure of selenocysteine-containing hGSTZ1c-1c based on site-directed mutagenesis and computational analysis.
23280616 2013 Characterization of selenium-containing glutathione transferase zeta1-1 with high GPX activity prepared in eukaryotic cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22729907 2012 Genetic polymorphisms of glutathione S-transferase Z1 (GSTZ1) and susceptibility to preeclampsia.
22576335 2013 MAP3K7 and GSTZ1 are associated with human longevity: a two-stage case-control study using a multilocus genotyping.
22561244 2012 Expression of selenocysteine-containing glutathione S-transferase in eukaryote.
22374552 2012 Association between three genetic polymorphisms of glutathione S-transferase Z1 (GSTZ1) and susceptibility to bipolar disorder.
22028318 2012 Prenatal and postnatal expression of glutathione transferase ? 1 in human liver and the roles of haplotype and subject age in determining activity with dichloroacetate.
21948024 Susceptibility to exudative age-related macular degeneration and three genetic polymorphisms of glutathione S-transferase Z1 (GSTZ1).
21823988 2012 Susceptibility to breast cancer and three polymorphisms of GSTZ1.
21269460 2011 Initial characterization of the human central proteome.
21183226 2011 Association between three genetic polymorphisms of glutathione S-transferase Z1 (GSTZ1) and susceptibility to schizophrenia.
21107728 2011 Genetic polymorphisms of glutathione S-transferase Z1 in an Iranian population.
20675267 2010 Polymorphisms in GSTT1, GSTZ1, and CYP2E1, disinfection by-products, and risk of bladder cancer in Spain.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20214911 2010 Preliminary examination of polymorphisms of GSTM1, GSTT1, and GSTZ1 in relation to semen quality.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20200426 2010 Glutathione pathway genetic polymorphisms and lung cancer survival after platinum-based chemotherapy.
19859803 2010 No evidence for glutathione S-transferases GSTA2, GSTM2, GSTO1, GSTO2, and GSTZ1 in breast cancer risk.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18776599 2008 Susceptibility genes for gentamicin-induced vestibular dysfunction.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18628685 2008 GSTz1 genotype and cognitive ability.
18373941 2008 A novel selenium-containing glutathione transferase zeta1-1, the activity of which surpasses the level of some native glutathione peroxidases.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17034008 2007 Glutathione S-transferase polymorphisms and onset age in alpha-synuclein A53T mutant Parkinson's disease.
16609361 2006 Polymorphisms in the human glutathione transferase zeta promoter.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15288444 2004 Case-only study of interactions between genetic polymorphisms of GSTM1, P1, T1 and Z1 and smoking in Parkinson's disease.
15173170 2004 Binding and kinetic mechanisms of the Zeta class glutathione transferase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12485442 2002 The GSTM1 null genotype confers an increased risk for solar keratosis development in an Australian Caucasian population.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11737895 2001 Investigation of glutathione S-transferase zeta and the development of sporadic breast cancer.
11640913 2001 A bird's eye view of the glutathione transferase field.
11327815 2001 Crystal structure of maleylacetoacetate isomerase/glutathione transferase zeta reveals the molecular basis for its remarkable catalytic promiscuity.
10739172 2000 Discovery of a functional polymorphism in human glutathione transferase zeta by expressed sequence tag database analysis.
10373324 1999 Gene structure, chromosomal location, and expression pattern of maleylacetoacetate isomerase.
9925947 1998 Characterization and chromosome location of the gene GSTZ1 encoding the human Zeta class glutathione transferase and maleylacetoacetate isomerase.
9815194 1998 Glutathione transferase zeta-catalyzed biotransformation of dichloroacetic acid and other alpha-haloacids.
9531472 1998 Glutathione transferase zeta catalyses the oxygenation of the carcinogen dichloroacetic acid to glyoxylic acid.
9417084 1998 Characterization of a fungal maleylacetoacetate isomerase gene and identification of its human homologue.
9396740 1997 Zeta, a novel class of glutathione transferases in a range of species from plants to humans.