Property Summary

NCBI Gene PubMed Count 40
PubMed Score 15.70
PubTator Score 25.65

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (23)

PMID Text
21598179 Polyphenol metabolites did not affect cell number but significantly upregulated GSTT2 expression and decreased COX-2.
21349909 analysis of glutathione S-transferase copy number variation alters lung gene expression
20437850 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200426 Observational study of gene-disease association. (HuGE Navigator)
19860743 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19751749 Observational study of gene-disease association. (HuGE Navigator)
19696791 Observational study of gene-disease association. (HuGE Navigator)
19582785 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19528963 GSTM1 (1p13.3) and GSTT2 (22q11.23) showed a statistically significant association of non-null genotypes at both loci with an additive effect for increased vulnerability to schizophrenia
19528963 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18449862 Observational study of gene-disease association. (HuGE Navigator)
18268125 PAH-DNA adduct formation could be modulated by common genetic variants in GSTT2 in African American, Dominican and Caucasian mothers and newborns.
18268125 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18258609 Observational study of gene-disease association. (HuGE Navigator)
18186040 Observational study of gene-disease association. (HuGE Navigator)
17250773 Observational study of gene-disease association. (HuGE Navigator)
17250773 single nucleotide polymorphisms and haplotypes of the GSTT2 promoter region are associated with colorectal cancer risk in the Korean population
16006997 Observational study of gene-disease association. (HuGE Navigator)
15654505 Observational study of gene-disease association. (HuGE Navigator)
12871945 dinitrosyl-diglutathionyl-iron complex, a natural carrier of nitric oxide, binds with extraordinary affinity to GSTA1-1, which is explained by molecular modeling and related to molecular evolution

AA Sequence

MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAI      1 - 70
LIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMD     71 - 140
QALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAH    141 - 210
SIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP                                        211 - 244
//

Text Mined References (40)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21598179 2011 Impact of polyphenol metabolites produced by colonic microbiota on expression of COX-2 and GSTT2 in human colon cells (LT97).
21349909 2011 Glutathione S-transferase copy number variation alters lung gene expression.
20437850 Alcohol, tobacco and genetic susceptibility in relation to cancers of the upper aerodigestive tract in northern Italy.
20200426 2010 Glutathione pathway genetic polymorphisms and lung cancer survival after platinum-based chemotherapy.
19860743 2010 Effect of gene-environment Interactions on mental development in African American, Dominican, and Caucasian mothers and newborns.
19751749 2009 Risk of malignant pleural mesothelioma and polymorphisms in genes involved in the genome stability and xenobiotics metabolism.
19696791 2009 Association between polymorphisms in glutathione S-transferase Mu3 and IgG titer levels in serum against Helicobacter pylori.
19582785 2010 Methods for detecting interactions between genetic polymorphisms and prenatal environment exposure with a mother-child design.
19528963 2010 Association of common copy number variants at the glutathione S-transferase genes and rare novel genomic changes with schizophrenia.
19424424 2009 Linkage disequilibrium between two high-frequency deletion polymorphisms: implications for association studies involving the glutathione-S transferase (GST) genes.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18449862 2009 Association study between the genetic polymorphisms of glutathione-related enzymes and schizophrenia in a Japanese population.
18268125 2008 Assessment of interactions between PAH exposure and genetic polymorphisms on PAH-DNA adducts in African American, Dominican, and Caucasian mothers and newborns.
18258609 2008 A comprehensive analysis of phase I and phase II metabolism gene polymorphisms and risk of non-small cell lung cancer in smokers.
18186040 2008 Association study between polymorphisms in glutathione-related genes and methamphetamine use disorder in a Japanese population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17250773 2007 GSTT2 promoter polymorphisms and colorectal cancer risk.
16006997 2005 A comprehensive analysis of phase I and phase II metabolism gene polymorphisms and risk of colorectal cancer.
15654505 2005 Association of habitual smoking and drinking with single nucleotide polymorphism (SNP) in 40 candidate genes: data from random population-based Japanese samples.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12871945 2003 The specific interaction of dinitrosyl-diglutathionyl-iron complex, a natural NO carrier, with the glutathione transferase superfamily: suggestion for an evolutionary pressure in the direction of the storage of nitric oxide.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
10975610 2000 Characterization of the glutathione S-transferase GSTT1 deletion: discrimination of all genotypes by polymerase chain reaction indicates a trimodular genotype-phenotype correlation.
10760690 2000 Expression of glutathione S-transferase alpha, P1-1 and T1-1 in the human gastrointestinal tract.
10591208 1999 The DNA sequence of human chromosome 22.
10426791 1999 Expression of glutathione S-transferase theta class isoenzymes in human colorectal and gastric cancers.
9729470 1998 Structure and organization of the human theta-class glutathione S-transferase and D-dopachrome tautomerase gene complex.
9551553 1998 Human theta class glutathione transferase: the crystal structure reveals a sulfate-binding pocket within a buried active site.
9037717 1997 Homology model for the human GSTT2 Theta class glutathione transferase.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8761485 1996 The distribution of theta-class glutathione S-transferases in the liver and lung of mouse, rat and human.
8617495 1996 Chromosomal localization of the gene for the human theta class glutathione transferase (GSTT1).
8617493 1996 Characterization of a cDNA and gene encoding the mouse theta class glutathione transferase mGSTT2 and its localization to chromosome 10B5-C1.
7789971 1995 Molecular cloning of a cDNA and chromosomal localization of a human theta-class glutathione S-transferase gene (GSTT2) to chromosome 22.
1417752 1992 Characterization of a human class-Theta glutathione S-transferase with activity towards 1-menaphthyl sulphate.