Property Summary

NCBI Gene PubMed Count 189
PubMed Score 235.64
PubTator Score 287.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
nephrosclerosis -2.038 3.8e-02
adrenocortical carcinoma -2.936 2.3e-02
primary pancreatic ductal adenocarcinoma -1.471 1.4e-02
non-small cell lung cancer 1.745 1.2e-03
intraductal papillary-mucinous adenoma (... -2.000 4.8e-03
intraductal papillary-mucinous carcinoma... -2.800 1.1e-02
intraductal papillary-mucinous neoplasm ... -3.600 4.9e-03
colon cancer -1.800 4.9e-02
pancreatic cancer -2.200 7.1e-04
diabetes mellitus 1.100 1.3e-03
cystic fibrosis 3.700 1.4e-05
aldosterone-producing adenoma -3.318 2.0e-02
nasopharyngeal carcinoma -4.100 9.6e-07
lung carcinoma -1.200 3.0e-03
Breast cancer -1.600 4.0e-09
ulcerative colitis -1.500 3.5e-03
head and neck cancer and chronic obstruc... -1.200 1.2e-02
psoriasis -1.600 7.8e-12

Synonym

Accession P08263 Q14750 Q5GHF8 Q5SZC1
Symbols GST2
GTH1
GSTA1-1
GST-epsilon

Gene

PDB

1LBK   1GSD   1GSE   1GSF   1GUH   1K3L   1K3O   1K3Y   1PKW   1PKZ   1PL1   1PL2   1USB   1XWG   1YDK   2R3X   2R6K   3I69   3I6A   3IK9   3KTL   3L0H   3Q74   3U6V   3ZFB   3ZFL   4HJ2   5LCZ  

Protein-protein Interaction (5)

Gene RIF (173)

PMID Text
26552558 The frequency of GSTA1, GSTM1 and GSTP1 genotypes was not significantly different between progressive myoclonus epilepsy patients and controls
26419450 this is the first population pharmacokinetic study to suggest that GSTA1 polymorphisms in adults are associated with busulfan pharmacokinetics
26321410 GSTA1 polymorphism is associated with different pregnancy-related conditions
26222310 Patients with a GSTA1*A heterozygous variant had a lower exposure to 4-hydroxycyclophosphamide (4OHCTX) during cyclophosphamide treatment of lupus nephritis compared to wild-type patients.
25867434 Data show that the distribution of the glutathione S-transferases alleles GSTA1*A/*B and GSTP1*A, *B, and *C in the Polish population correspond to the results of studies in Caucasians.
25778330 Review/Meta-analysis: suggest that GSTA1 BB genotype was a risk factor for colorectal cancer, especially in Caucasian populations.
25730183 the differences of PK in BU among different ethnic groups existed because of the different distribution frequencies of GST gene polymorphism in Chinese patients and Caucasian patients.
25565670 GST genotyping before hematopoietic stem cell transplantation may allow better prediction of busulfan pharmacokinetics and drug toxicity, and thereby improve outcome after busulfan and cyclophosphamide conditioning
25374180 Our data indicated that GSTA1 expression may be a target molecule in early diagnosis and treatment of lung cancer
25251951 The distribution of genotype frequencies of the polymorphism GSTA1 was statistically different between cases and controls, and the presence of genotypes A / B and B / B suggests a protective role against the risk of PCa compared to genotype A / A.
25111321 The study found that GSTA1 polymorphism was associated with increased risk of Balkan endemic nephropathy.
24914957 The role of the glutathione S-transferase A1, M1, P1 and T1 gene polymorphisms and potential effect modification by occupational exposure to different chemicals in Serbian bladder cancer male patients, was investigated.
24782212 Data suggest that cytochrome P450 3A4- and glutathione S-transferase A1-transfected -hepatoma cell line C3A may become a cell material in the biochemical artificial liver system.
24612768 Increased GSTA1 levels are associated with delayed graft function.
24471578 The GSTA1*-69T and GSTO2*D142 variants are both associated with a significantly increased risk of asthma.
24423050 Combined GSTM1*0/GSTA1*A genotypes might be considered as genetic markers for cardiovascular death risk in ESRD patients, which may permit targeting of preventive and early intervention.
24390679 The polymorphism of GSTA1 (rs3957357) may not be associated with the risk of recurrent spontaneous abortion in Chinese Han population.
24344877 High expression of GSTA1 is associated with chronic obstructive pulmonary disease.
24276031 Polymorphisms in GSTA1 gene is associated with secondary mixed phenotype acute leukemia.
24215845 Data indicate that GSTA1 genotype may be predictive for doxorubicin efficacy but warrants further study.
24192117 GSTA1 and CYP39A1 were found to be associated with busulfan clearance. When combined, the two haplotypes explained 17% of the variability in busulfan clearance.
24075358 Data indicate that genotypes of the GSTA1, GSTM1, GSTT1, and GSTP1 did not contribute independently towards the risk of bladder cancer, but in association with smoking, both GSTA1 and GSTM1 increase individual susceptibility to bladder cancer.
23731957 GSTA1 low or intermediate genoytpe was associated with a non-significant protective effect for esophageal adenocarcinoma and esophageal squamous cell carcinoma.
23650189 Data indicate that steroidogenic factor 1 (SF-1) and glutathione S-transferase A (GSTA) family genes (hGSTA1-hGSTA4) are involved in steroidogenesis.
23649628 Data indicate that the GSTA1-1 catalytic promiscuity correlates strongly with characteristics of the thermodynamic partition function.
23647087 Report increased GSTA1 in airways of asthmatics.
23570881 The GST genetic variants examined were not associated with susceptibility to coronary artery disease in our Taiwanese cohort.
23460799 The interaction of the chemotherapeutic drug chlorambucil (CBL) with human GSTA1-1 (hGSTA1-1) using kinetic analysis, protein crystallography and molecular dynamics, is reprted.
23394311 GSTM1 and GSTA1 polymorphisms significantly impact the malignant potential of transitional cell carcinoma of the urinary bladder.
23292236 GSTA1*A2 haplotype was associated with lower drug levels and higher drug clearance (P </= 0.03). Gene-dosage effect was also observed (P </= 0.007). GSTA1 haplotypes were associated with HSCT outcomes.
23251616 GSTA1 levels may play a role in modulating enterocyte proliferation but do not influence differentiation or apoptosis.
22993865 Ceramide may increase resistance to chemotherapeutics in Caco-2 cells by up-regulating the expression of GSTA1.
22959778 Results confirmed that patients with schizophrenia who were carriers of the GSTA1 *B risk allele had an increased MD in bilateral thalami and increased severity of auditory and global hallucinations in comparison with non-B carriers.
22906494 The data suggest that menadione-induced JNK activation involves the production of reactive oxygen species, likely superoxide anion, and intracellular GSH levels play an important role in preventing GSTA1-JNK complex dissociation.
22893351 GST-a levels significantly correlated with exposure from mercury-containing dental amalgams in a dose-dependent fashion.
22697302 Variability in GST genes (GSTA1, GSTT1, GSTP1, GSTA1) is not a major determinant of colorectal cancer susceptibility in the Central European population.
22633257 A significant association is found between the GSTA1 gene and an increased risk of recurrent miscarriage.
22475179 Polymorphisms in genes encoding interleukin-10 and drug metabolizing enzymes GSTP1, GSTT1, GSTA1 and UGT1A1 influence risk and outcome in Hodgkin lymphoma.
22079734 After adjustment of confounding factors, GSTP1 Ile105Val, GSTA1 C-69T, and TGFbeta1 T869C polymorphisms were found to be significantly associated with the risk of Grade 2-3 radiation-induced fibrosis.
22040239 GSTA1 and the GSTO2 are asthma susceptible genes involved in increasing the risk of asthma development in the Italian population
22002059 The barrierless rearrangement of the GSTA1-1 active site within a local smooth energy landscape suggests a thermodynamic basis for catalytic promiscuity
21844655 By direct resequencing of the 5'-flanking region, all the exons, and their flanking introns for 107 patients, 29 and 27 variants were identified in GSTA1 and GSTA2, respectively.
21749698 Data show that higher significant risk of developing erythema in patients with SNPS in XRCC1, XRCC3 and GSTA1.
21530499 From the total of 117 samples, 43.5% are homozygous for hGSTA1*A allele, 13% are homozygous for hGSTA1*B allele and 43.5% are hGSTA1*A/B heterozygotes.
21530062 Tyr-9-induced localisation of a C-terminal helix (alpha9)of glutathione transferase A1-1 was ligand dependent, suggesting that the phenolic hydroxyl group of the active site tyrosine influences alpha9 dynamics by mediating the orientation of the bound ligand.
21169260 Odds ratios for grade 3 and 4 hematologic toxicity in the treated group and hazard ratios for DFS associated with selected functional polymorphisms in CYP2B6CYP3A4GSTA1 and GSTP1 were estimated by logistic regression.
21163259 Even with typical substrates, the astonishing concentration of glutathione transferase present in hepatocytes, causes an unusual "inverted" kinetics whereby the classical trends of v versus E and v versus S are reversed
21093063 This study found that the combination of the absence of GSTM1 gene and the of the GSTM1 gene with the polymorphism GSTA1*B/*B represents a risk factor for schizophrenia.
20833278 Study demonstrates that the stability of the domain-domain interface plays a role in mediating the catalytic functionality of the active site, particularly the H-site, of class alpha GSTs.
20672371 Polymorphisms in GSTA1 is associated with lower busulfan pharmacokinetics in children with congenital hemoglobinopathies undergoing hematopoietic stem cell transplantation.
20672371 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20529827 There were no significant associations between glutathione-S-transferases and p53 expressions and tumor stage, tumor grade and smoking status (p>0.05).
20437058 Observational study of genetic testing. (HuGE Navigator)
20391138 Observational study of gene-disease association. (HuGE Navigator)
20377137 The homozygous wild-type GSTA1 polymorphism is associated with gastric cancer.
20377137 Observational study of gene-disease association. (HuGE Navigator)
20374258 The distribution of the GSTO1 genotype was nearly equal between the control group and asthmatics
20374258 Observational study of gene-disease association. (HuGE Navigator)
20368715 Observational study of gene-disease association. (HuGE Navigator)
20367187 the frequencies of GSTA1 (glutathione S-transferase alpha 1), GSTM1(GST mu 1 ), GSTO2(GST omega 2) and GSTT1 (GST theta 1) genotypes found in asthmatic patients differ from those of controls
20367187 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20331903 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20216541 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20207535 GSTA1 *A/*B polymorphism was not associated with colorectal cancer risk.
20207535 Meta-analysis of gene-disease association. (HuGE Navigator)
20200426 Observational study of gene-disease association. (HuGE Navigator)
20102361 Observational study of gene-disease association. (HuGE Navigator)
20100551 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20056632 There was no effect modification of glucosinolate intake and prostate cancer risk by GSTA1 (G-52A) or GSTP1 (A313G) genotype
20056632 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20032816 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19959275 the contribution made by Arg15 towards ligand binding and enzyme stability
19953622 T allele of GSTA1 could be a protective factor for tumor size progression in Taiwanese with oral cancer
19953622 Observational study of gene-disease association. (HuGE Navigator)
19902075 The increase in activities of glutathione-S-transferase was maximum in patients with the most severe burns.
19896490 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19786980 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19696793 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19639209 Observational study of gene-disease association. (HuGE Navigator)
19618965 In contrast to the preorganized hydrophobic binding pocket that accommodates alkenals in GSTA4-4, GSTA1-1 includes a dynamic alpha9 helix that undergoes a ligand-dependent localization to complete the active site.
19584821 ). No association was found between busulfan exposure and major GSTA1 or GSTP1 gene variants
19584821 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19515364 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19491810 Frequencies of normal alleles of GST genotypes were lower in patients with Down's syndrome as compared to the controls.
19448608 Genotypic variants of CYBA rs4673 and GSTA1 rs3957357 were independent predictors of event free survival in diffuse large B-cell lymphoma treated with R-CHOP21
19376514 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19076156 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19062541 Observational study of genotype prevalence. (HuGE Navigator)
19027952 Frequencies of polymorphic variants of RAD51, XRCC3, NQO1, GSTA1, GSTM1, GSTT1, CYP3A4 and XPD enzymes were similar in patients and controls.
19027952 Observational study of gene-disease association. (HuGE Navigator)
18992148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18854779 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18791061 EdAG was identified as a metabolite of busulfan in a human liver cytosol and found to bind GSTA1-1
18784548 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18644106 Data show that GST-alpha expression is not seen in any cortex specimens from intractable epileptic patients and controls.
18641537 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18635758 Glutathione S-transferase A1 genetic variants reduce busulfan clearance in children undergoing hematopoietic cell transplantation.
18635758 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18496131 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18476723 Keap1-dependent signaling pathway for the induction of the constitutive GST A1 expression during epithelial cell differentiati in Caco-2 cells.
18430527 This is the first report to show that the GSTA1*B allele is a potential risk factor for smoking-related type 2 diabetes.
18430527 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18414193 Polymorphisms of glutathione S-transferase A1 and O1 and breast cancer among postmenopausal Danish women.
18414193 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18300949 The risk of hypertension was significantly increased in the GSTA1*B allele carriers having also the GSTM1 null genotype or both the GSTM1 and GSTT1 null genotypes.
18300949 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18224491 The aim of the present study is to investigate the influence of cytochromes P450 (CYP450) 1A1*2C and Glutathione S-transferases (GSTs) (T1 and M1) gene polymorphisms in susceptibility to chronic myeloid leukaemia (CML).
18214047 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18186040 Observational study of gene-disease association. (HuGE Navigator)
18161889 Observational study of gene-disease association. (HuGE Navigator)
18066575 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18065725 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
17899366 a possible use of ARNT2 and GST A1 as prognostic breast cancer biomarkers.
17716224 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17716224 Polymorphisms affecting GSTP1, GST alpha 1 and GSTM3 genes are probably not related to the risk of developing hepatocellular carcinoma in a population of white Spanish patients.
17644396 Observational study of gene-disease association. (HuGE Navigator)
17644396 GSTA1 polymorphisms is associated with dnan damage induced by tobacco smoke
17631926 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)
17425746 Observational study of gene-disease association. (HuGE Navigator)
17374652 Observational study of gene-disease association. (HuGE Navigator)
17333241 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17197702 dinitrosyl-diglutathionyl-iron complex bound to Alpha class glutathione S-transferases with extraordinary high affinity in hepatocytes
17086718 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17071629 Observational study of gene-disease association. (HuGE Navigator)
17021248 IL-1beta represses GSTA1 transcription via a mechanism involving overexpression of variant HNF-1C.
16865249 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16786188 results indicate that certain content in maotai liquor is able to induce GST A1 ARE transcriptional expression, which may provide protective effects for hepatic cells via an ERKs- and p38 K-dependent pathway
16624829 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16624829 glutathione S-transferase A1 (GSTA1) genotype as well as diet may have roles in development of breast cancer
16599007 Observational study of gene-disease association. (HuGE Navigator)
16365014 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16280386 Observational study of genotype prevalence. (HuGE Navigator)
16280386 distribution of hGSTA1 gene is polymorphic in Chinese people
16190865 Both Met51 and Phe52 in the intersubunit lock-and-key motif play important structural roles in maintaining the catalytic and ligandin functions and stability of the GST dimer.
16116487 Observational study of gene-disease association. (HuGE Navigator)
15952767 communication between the two active sites of dimeric glutathione S-transferase A1-1
15900282 Observational study of gene-disease association. (HuGE Navigator)
15893769 crystal structure; mobile C-terminal region in apo human GSTA1-1 is structured and does not undergo ligand-induced folding
15808404 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15797627 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15797627 The frequency of GSTA1 *A/*B or *B/*B genotype was 24.3% in urothelial cancer cases, compared with 21.2% in the control groups (OR=1.22; 95%CI 0.87-1.72) after adjustment for age, gender and smoking status.
15757902 Disruption of the N-capping motif of helix 9 alters the conformational dynamics of the C-terminal region and, consequently, the features of the H-site to which hydrophobic substrates bind.
15746160 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15616829 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15616829 GSTA1 polymorphisms are associated with prostate cancer susceptibility, especially among smokers.
15525789 Observational study of gene-disease association. (HuGE Navigator)
15319294 Observational study of gene-disease association. (HuGE Navigator)
15202795 Observational study of genotype prevalence. (HuGE Navigator)
15202795 The frequency of the GSTA1*B allele in a Japanese population was found to be 16.0%.
15182170 Addition of glutathione (GSH) causes glutathione transferase A1-1 to become a stable alpha-helix
15128049 Observational study of gene-disease association. (HuGE Navigator)
14690442 Isoleucine-219 mutation to alanine results in a positional displacement of the carboxy-terminal region in GSTA1-1 having fewer interactions with the protein and, thus, diminished stability and reduction in catalytic function.
12871945 dinitrosyl-diglutathionyl-iron complex, a natural carrier of nitric oxide, binds with extraordinary affinity to GSTA1-1, which is explained by molecular modeling and related to molecular evolution
12524083 presence of glutathione S-transferases A1-1 and P1-1 in seminal fluid suggests a role in the protection against (oxidative) damage of spermatozoa
12516103 Observational study of gene-disease association. (HuGE Navigator)
12447480 Malignant lung tumors(squamous cell carcinoma and adenocarcinoma) had significantly increased levels of this enzyme.
12211029 X-ray Crystallography model of GSTA1 bound with S-hexyl glutathione bound reveals possible extended ligandin binding site.
12206662 Kinetic studies with completely glutathiolated GST A1-1 indicate that modification at cysteine-112 has no effect on catalytic turnover of the isoenzyme or the binding of nonsubstrate ligands.
12139976 expressed at high levels in duodenum and small intestine and expression decreased from proximal to distal small intestine
12093480 expression of hGSTA1/2 and hGSTA4 steady-state mRNAs in second trimester prenatal livers
12087351 Observational study of gene-disease association. (HuGE Navigator)
11931663 Thermodynamics of the ligandin function of human class Alpha glutathione transferase A1-1: energetics of organic anion ligand binding. (GSTA1-1)
11851347 ability of the two Alpha class subunit interfaces to adopt a functional heterodimeric structure
11747461 Deletion of Glu alpha-carboxylate from the substrate glutathione causes a drastic loss in the catalytic efficiency of GST A1-1, probably due to a combination of lowered affinity for the thiol substrate and raised pKa of the active-site-bound thiol group.
11692074 Observational study of gene-disease association. (HuGE Navigator)
11692074 Polymorphism identified in the proximal promoter of GSTA1 correlate with its expression in the liver and is expected to be of significance for individual risk of cancer or individual response to chemotherapeutic agents.
11550208 low level of expression seen in prostatic intraepithelial neoplasia and prostate adenocarcinoma, suggesting lack of detoxification activity that may be associated with carcinogenesis
11535243 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRA      1 - 70
ILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVL     71 - 140
KSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDE    141 - 210
KSLEEARKIFRF                                                              211 - 222
//

Text Mined References (191)

PMID Year Title
26552558 2015 GSTA1, GSTM1, GSTP1 and GSTT1 polymorphisms in progressive myoclonus epilepsy: A Serbian case-control study.
26419450 2015 Population pharmacokinetics and pharmacodynamics of busulfan with GSTA1 polymorphisms in patients undergoing allogeneic hematopoietic stem cell transplantation.
26321410 2015 GSTA1 gene variation associated with gestational hypertension and its involvement in pregnancy-related pathogenic conditions.
26222310 2015 The GSTA1 polymorphism and cyclophosphamide therapy outcomes in lupus nephritis patients.
25867434 2015 Polymorphisms and allele frequencies of glutathione S-transferases A1 and P1 genes in the Polish population.
25778330 Polymorphisms of GSTA1 contribute to elevated cancer risk: evidence from 15 studies.
25730183 2015 Once-daily i.v. BU-based conditioning regimen before allogeneic hematopoietic SCT: a study of influence of GST gene polymorphisms on BU pharmacokinetics and clinical outcomes in Chinese patients.
25565670 2015 Glutathione Transferase Gene Variants Influence Busulfan Pharmacokinetics and Outcome After Myeloablative Conditioning.
25374180 2014 Expression and function of GSTA1 in lung cancer cells.
25251951 Human glutathione S-transferase polymorphisms associated with prostate cancer in the Brazilian population.
25111321 2014 Is increased susceptibility to Balkan endemic nephropathy in carriers of common GSTA1 (*A/*B) polymorphism linked with the catalytic role of GSTA1 in ochratoxin a biotransformation? Serbian case control study and in silico analysis.
24914957 2014 Does occupational exposure to solvents and pesticides in association with glutathione S-transferase A1, M1, P1, and T1 polymorphisms increase the risk of bladder cancer? The Belgrade case-control study.
24782212 2014 Establishment of cytochrome P450 3A4 and glutathione S-transferase A1-transfected human hepatoma cell line and functional analysis.
24612768 2014 Glutathione S-transferase iso-enzymes in perfusate from pumped kidneys are associated with delayed graft function.
24471578 2014 GSTA1*-69C/T and GSTO2*N142D as asthma- and allergy-related risk factors in Italian adult patients.
24423050 2014 Associations of GSTM1*0 and GSTA1*A genotypes with the risk of cardiovascular death among hemodialyses patients.
24390679 2014 Glutathione S-transferase A1 polymorphism and the risk of recurrent spontaneous abortion in Chinese Han population.
24344877 2014 Expression of glutathione S-transferase variants in human airway wall after long-term response to sulfur mustard.
24276031 2014 Methylenetetrahydrofolate reductase and glutathione S-tranferase gene polymorphisms in secondary mixed phenotype acute leukemia: a case report.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24215845 2014 Brostallicin versus doxorubicin as first-line chemotherapy in patients with advanced or metastatic soft tissue sarcoma: an European Organisation for Research and Treatment of Cancer Soft Tissue and Bone Sarcoma Group randomised phase II and pharmacogenetic study.
24192117 2013 Effect of genetic variants GSTA1 and CYP39A1 and age on busulfan clearance in pediatric patients undergoing hematopoietic stem cell transplantation.
24075358 2013 GSTA1, GSTM1, GSTP1, and GSTT1 polymorphisms and susceptibility to smoking-related bladder cancer: a case-control study.
23731957 2013 No role for glutathione S-transferase genotypes in Caucasian esophageal squamous cell or adenocarcinoma etiology: an European case-control study.
23650189 2013 Human glutathione S-transferase A (GSTA) family genes are regulated by steroidogenic factor 1 (SF-1) and are involved in steroidogenesis.
23649628 2013 Enzymatic detoxication, conformational selection, and the role of molten globule active sites.
23647087 Expression pattern of GSTP1 and GSTA1 in the pathogenesis of asthma.
23570881 2013 GSTM1, GSTT1, GSTP1, and GSTA1 genetic variants are not associated with coronary artery disease in Taiwan.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23460799 2013 The interaction of the chemotherapeutic drug chlorambucil with human glutathione transferase A1-1: kinetic and structural analysis.
23394311 2013 GSTM1-null and GSTA1-low activity genotypes are associated with enhanced oxidative damage in bladder cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23292236 2013 Glutathione S-transferase gene variations influence BU pharmacokinetics and outcome of hematopoietic SCT in pediatric patients.
23251616 2012 Low levels of GSTA1 expression are required for Caco-2 cell proliferation.
22993865 2012 [Effect of ceramide on GSTA1 in Caco-2 cells].
22959778 Glutathione S-transferase alpha 1 risk polymorphism and increased bilateral thalamus mean diffusivity in schizophrenia.
22906494 2012 The effect of menadione on glutathione S-transferase A1 (GSTA1): c-Jun N-terminal kinase (JNK) complex dissociation in human colonic adenocarcinoma Caco-2 cells.
22893351 2013 A significant dose-dependent relationship between mercury exposure from dental amalgams and kidney integrity biomarkers: a further assessment of the Casa Pia children's dental amalgam trial.
22697302 2012 Common polymorphisms in GSTM1, GSTT1, GSTP1, GSTA1 and susceptibility to colorectal cancer in the Central European population.
22633257 2012 Glutathione S-transferase genes and the risk of recurrent miscarriage in Italian women.
22475179 2012 Polymorphisms in genes encoding interleukin-10 and drug metabolizing enzymes GSTP1, GSTT1, GSTA1 and UGT1A1 influence risk and outcome in Hodgkin lymphoma.
22079734 2012 Common variants of GSTP1, GSTA1, and TGF?1 are associated with the risk of radiation-induced fibrosis in breast cancer patients.
22040239 2011 Functional polymorphisms of GSTA1 and GSTO2 genes associated with asthma in Italian children.
22002059 2011 Ensemble perspective for catalytic promiscuity: calorimetric analysis of the active site conformational landscape of a detoxification enzyme.
21844655 2011 Genetic variation and haplotype structures of the glutathione S-transferase genes GSTA1 and GSTA2 in Japanese colorectal cancer patients.
21749698 2011 Dose and polymorphic genes xrcc1, xrcc3, gst play a role in the risk of articledeveloping erythema in breast cancer patients following single shot partial breast irradiation after conservative surgery.
21530499 2011 Analysis of human glutathione S-transferase alpha 1 (hGSTA1) gene promoter polymorphism using denaturing high performance liquid chromatography (DHPLC).
21530062 2011 Energetics of ligand binding to human glutathione transferase A1-1: Tyr-9 associated localisation of the C-terminal helix is ligand-dependent.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21169260 2010 Gene polymorphisms in cyclophosphamide metabolism pathway,treatment-related toxicity, and disease-free survival in SWOG 8897 clinical trial for breast cancer.
21163259 2011 The extended catalysis of glutathione transferase.
21093063 2011 Genetic polymorphisms of glutathione S-transferases GSTM1, GSTT1, GSTP1 and GSTA1 as risk factors for schizophrenia.
20833278 2010 Stability of the domain interface contributes towards the catalytic function at the H-site of class alpha glutathione transferase A1-1.
20672371 2010 Influence of glutathione S-transferase A1, P1, M1, T1 polymorphisms on oral busulfan pharmacokinetics in children with congenital hemoglobinopathies undergoing hematopoietic stem cell transplantation.
20606271 2010 The role of a topologically conserved isoleucine in glutathione transferase structure, stability and function.
20529827 2010 The expression of GST isoenzymes and p53 in non-small cell lung cancer.
20437058 2010 The utility and predictive value of combinations of low penetrance genes for screening and risk prediction of colorectal cancer.
20391138 2010 Lifestyle, environmental, and genetic predictors of bulky DNA adducts in a study population nested within a prospective Danish cohort.
20377137 2010 Genetic polymorphisms in GSTA1, GSTP1, GSTT1, and GSTM1 and gastric cancer risk in a Vietnamese population.
20374258 2010 GSTA1, GSTO1 and GSTO2 gene polymorphisms in Italian asthma patients.
20368715 2011 Tumor response is predicted by patient genetic profile in rectal cancer patients treated with neo-adjuvant chemo-radiotherapy.
20367187 2010 Glutathione S-transferase gene polymorphisms and air pollution as interactive risk factors for asthma in a multicentre Italian field study: A preliminary study.
20331903 2010 Glutathione S-Transferase P1 (GSTP1) gene polymorphism increases age-related susceptibility to hepatocellular carcinoma.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20216541 2010 Oxaliplatin, irinotecan and capecitabine as first-line therapy in metastatic colorectal cancer (mCRC): a dose-finding study and pharmacogenomic analysis.
20207535 2010 GSTM1, GSTT1, GSTP1, GSTA1 and colorectal cancer risk: a comprehensive meta-analysis.
20200426 2010 Glutathione pathway genetic polymorphisms and lung cancer survival after platinum-based chemotherapy.
20102361 2010 Genotype frequencies of selected drug metabolizing enzymes and ABC drug transporters among breast cancer patients on FAC chemotherapy.
20100551 2010 Occupational exposure to low levels of benzene: Biomarkers of exposure and nucleic acid oxidation and their modulation by polymorphic xenobiotic metabolizing enzymes.
20056632 2010 Dietary glucosinolate intake, polymorphisms in selected biotransformation enzymes, and risk of prostate cancer.
20032816 2010 The GSTP1 Ile105 Val polymorphism modifies the metabolism of toluene di-isocyanate.
19959275 2010 Arginine 15 stabilizes an S(N)Ar reaction transition state and the binding of anionic ligands at the active site of human glutathione transferase A1-1.
19953622 2010 Glutathione S-transferase P1 and alpha gene variants; role in susceptibility and tumor size development of oral cancer.
19902075 2009 Activity of antioxidant enzymes in the wound in patients with deep burns.
19896490 2010 Low 8-oxo-7,8-dihydro-2'-deoxyguanosine levels and influence of genetic background in an Andean population exposed to high levels of arsenic.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19786980 2010 Genetic polymorphisms and the efficacy and toxicity of cisplatin-based chemotherapy in ovarian cancer patients.
19696793 2009 Association study of genetic polymorphism in ABCC4 with cyclophosphamide-induced adverse drug reactions in breast cancer patients.
19639209 2009 The role of GSTA2 polymorphisms and haplotypes in breast cancer susceptibility: a case-control study in the Portuguese population.
19618965 2009 Structural analysis of a glutathione transferase A1-1 mutant tailored for high catalytic efficiency with toxic alkenals.
19584821 2010 Influence of GST gene polymorphisms on busulfan pharmacokinetics in children.
19515364 2009 Genetic background of lead and mercury metabolism in a group of medical students in Austria.
19491810 2009 [Gene polymorphisms in patients with Down's syndrome].
19448608 2009 Analysis of the host pharmacogenetic background for prediction of outcome and toxicity in diffuse large B-cell lymphoma treated with R-CHOP21.
19376514 2010 Association of cyclophosphamide drug-metabolizing enzyme polymorphisms and chemotherapy-related ovarian failure in breast cancer survivors.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19076156 2009 Polymorphisms of drug-metabolizing enzymes (GST, CYP2B6 and CYP3A) affect the pharmacokinetics of thiotepa and tepa.
19062541 2008 [Glutathione-S-transferase gene polymorphism in Russian populations of European Russia].
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19027952 2009 Polymorphisms of detoxification and DNA repair enzymes in myelodyplastic syndromes.
18992148 2008 Low-penetrance alleles predisposing to sporadic colorectal cancers: a French case-controlled genetic association study.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18854779 2008 Relations between polymorphisms in drug-metabolising enzymes and toxicity of chemotherapy with cyclophosphamide, thiotepa and carboplatin.
18791061 2008 Dehydroalanine analog of glutathione: an electrophilic busulfan metabolite that binds to human glutathione S-transferase A1-1.
18784548 2008 Lung function in relation to 2-thiothiazolidine-4-carboxylic acid and genetic effect modification among rubber workers in Sweden.
18644106 2008 Expressions of glutathione S-transferase alpha, mu, and pi in brains of medically intractable epileptic patients.
18641537 2008 Glutathione S-transferase polymorphisms are not associated with population pharmacokinetic parameters of busulfan in pediatric patients.
18635758 2008 Glutathione S-transferase A1 genetic variants reduce busulfan clearance in children undergoing hematopoietic cell transplantation.
18496131 2008 Influence of polymorphisms of drug metabolizing enzymes (CYP2B6, CYP2C9, CYP2C19, CYP3A4, CYP3A5, GSTA1, GSTP1, ALDH1A1 and ALDH3A1) on the pharmacokinetics of cyclophosphamide and 4-hydroxycyclophosphamide.
18476723 2008 Keap1 regulates the constitutive expression of GST A1 during differentiation of Caco-2 cells.
18430527 2008 Glutathione S-transferase A1 polymorphism as a risk factor for smoking-related type 2 diabetes among Japanese.
18414193 2008 Polymorphisms of glutathione S-transferase A1 and O1 and breast cancer among postmenopausal Danish women.
18300949 2008 Association between glutathione S-transferase A1, M1 and T1 polymorphisms and hypertension.
18224491 2008 CYP1A1, GST gene polymorphisms and risk of chronic myeloid leukemia.
18214047 Pharmacogenetic analysis of liver toxicity after busulfan/cyclophosphamide-based allogeneic hematopoietic stem cell transplantation.
18186040 2008 Association study between polymorphisms in glutathione-related genes and methamphetamine use disorder in a Japanese population.
18161889 2008 Detoxification enzyme polymorphisms are not involved in duodenal adenomatosis in familial adenomatous polyposis.
18066575 2008 Influence of glutathione-related genes on symptoms and immunologic markers among vulcanization workers in the southern Sweden rubber industries.
18065725 2008 Genetic variants of glutathione S-transferase as possible risk factors for hepatocellular carcinoma: a HuGE systematic review and meta-analysis.
17899366 2008 Drug metabolism-related genes as potential biomarkers: analysis of expression in normal and tumour breast tissue.
17716224 2007 Glutathione S-transferases pi 1, alpha 1 and M3 genetic polymorphisms and the risk of hepatocellular carcinoma in humans.
17644396 2007 Influence of glutathione S-transferase polymorphisms on genotoxic effects induced by tobacco smoke.
17631926 2007 Occupational exposure to antineoplastic agents induces a high level of chromosome damage. Lack of an effect of GST polymorphisms.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17425746 Glutathione S-transferase A1 polymorphisms and acute graft-vs.-host disease in HLA-matched sibling allogeneic hematopoietic stem cell transplantation.
17374652 2007 GSTM1, GSTT1, GSTP1, and GSTA1 polymorphisms and urinary isothiocyanate metabolites following broccoli consumption in humans.
17333241 2007 Levels of 2-thiothiazolidine-4-carboxylic acid (TTCA) and effect modification of polymorphisms of glutathione-related genes in vulcanization workers in the southern Sweden rubber industries.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17197702 2007 Glutathione transferases sequester toxic dinitrosyl-iron complexes in cells. A protection mechanism against excess nitric oxide.
17086718 2006 [Study on the genetic polymorphisms of human glutathione-S-transferase A1 in Hakka population in South China].
17071629 2007 Glutathione S-transferase phenotypes in relation to genetic variation and fruit and vegetable consumption in an endoscopy-based population.
17021248 2007 Repression of human GSTA1 by interleukin-1beta is mediated by variant hepatic nuclear factor-1C.
16865249 2006 Potential application of GSTT1-null genotype in predicting toxicity associated to 5-fluouracil irinotecan and leucovorin regimen in advanced stage colorectal cancer patients.
16786188 2006 Essential roles of ERKs and p38K in up-regulation of GST A1 expression by Maotai content in human hepatoma cell line Hep3B.
16624829 2006 Effects of glutathione S-transferase A1 (GSTA1) genotype and potential modifiers on breast cancer risk.
16624487 2006 Metabolism of oxidized linoleic acid by glutathione transferases: peroxidase activity toward 13-hydroperoxyoctadecadienoic acid.
16599007 2004 Polymorphisms in glutathione-related genes affect methylmercury retention.
16421451 2006 New crystal structures of human glutathione transferase A1-1 shed light on glutathione binding and the conformation of the C-terminal helix.
16365014 2005 GSTP1 and GSTA1 polymorphisms interact with cruciferous vegetable intake in colorectal adenoma risk.
16280386 2006 Genetic analysis of glutathione S-transferase A1 polymorphism in the Chinese population and the influence of genotype on enzymatic properties.
16190865 2006 The intersubunit lock-and-key motif in human glutathione transferase A1-1: role of the key residues Met51 and Phe52 in function and dimer stability.
16116487 2005 Association of cyclophosphamide pharmacokinetics to polymorphic cytochrome P450 2C19.
15952767 2005 Communication between the two active sites of glutathione S-transferase A1-1, probed using wild-type-mutant heterodimers.
15900282 2005 Common genetic variants of microsomal epoxide hydrolase affect warfarin dose requirements beyond the effect of cytochrome P450 2C9.
15893769 2005 Tertiary interactions stabilise the C-terminal region of human glutathione transferase A1-1: a crystallographic and calorimetric study.
15808404 2005 Genetic polymorphisms in CYP1B1, GSTA1, NQO1 and NAT2 and the risk of lung cancer.
15797627 2005 Human glutathion S-transferase A1 polymorphism and susceptibility to urothelial cancer in the Japanese population.
15757902 2005 A conserved N-capping motif contributes significantly to the stabilization and dynamics of the C-terminal region of class Alpha glutathione S-transferases.
15746160 2005 Constitutional short telomeres are strong genetic susceptibility markers for bladder cancer.
15616829 2005 Human glutathione S-transferase A1, T1, M1, and P1 polymorphisms and susceptibility to prostate cancer in the Japanese population.
15525789 The role of polymorphisms of glutathione S-transferases GSTM1, M3, P1, T1 and A1 in susceptibility to alcoholic liver disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15333749 2004 Incorporation of a single His residue by rational design enables thiol-ester hydrolysis by human glutathione transferase A1-1.
15319294 2004 Genetic polymorphisms in UDP-glucuronosyltransferases and glutathione S-transferases and colorectal cancer risk.
15202795 2004 Genetic analysis of glutathione S-transferase A1 and T1 polymorphisms in a Japanese population.
15182170 2004 Glutathione induces helical formation in the carboxy terminus of human glutathione transferase A1-1.
15128049 2004 Human glutathione S-transferase A2 polymorphisms: variant expression, distribution in prostate cancer cases/controls and a novel form.
14690442 2003 Residue 219 impacts on the dynamics of the C-terminal region in glutathione transferase A1-1: implications for stability and catalytic and ligandin functions.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12871945 2003 The specific interaction of dinitrosyl-diglutathionyl-iron complex, a natural NO carrier, with the glutathione transferase superfamily: suggestion for an evolutionary pressure in the direction of the storage of nitric oxide.
12524083 2003 Glutathione and glutathione S-transferases A1-1 and P1-1 in seminal plasma may play a role in protecting against oxidative damage to spermatozoa.
12516103 2003 Association between a glutathione S-transferase A1 promoter polymorphism and survival after breast cancer treatment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473455 2003 Engineering a new C-terminal tail in the H-site of human glutathione transferase P1-1: structural and functional consequences.
12447480 2002 Activity of glutathione-metabolizing and antioxidant enzymes in malignant and benign tumors of human lungs.
12211029 2002 1.3-A resolution structure of human glutathione S-transferase with S-hexyl glutathione bound reveals possible extended ligandin binding site.
12206662 2002 Kinetic characterization of native and cysteine 112-modified glutathione S-transferase A1-1: reassessment of nonsubstrate ligand binding.
12139976 2002 Interindividual variation and organ-specific patterns of glutathione S-transferase alpha, mu, and pi expression in gastrointestinal tract mucosa of normal individuals.
12093480 2002 Comparative expression of two alpha class glutathione S-transferases in human adult and prenatal liver tissues.
12087351 2002 Genetic polymorphisms of glutathione S-transferase A1, the major glutathione S-transferase in human liver: consequences for enzyme expression and busulfan conjugation.
12042665 2002 The human glutathione transferase alpha locus: genomic organization of the gene cluster and functional characterization of the genetic polymorphism in the hGSTA1 promoter.
11931663 2002 Thermodynamics of the ligandin function of human class Alpha glutathione transferase A1-1: energetics of organic anion ligand binding.
11851347 2002 Hybridization of alpha class subunits generating a functional glutathione transferase A1-4 heterodimer.
11692074 2001 Effect of polymorphism in the human glutathione S-transferase A1 promoter on hepatic GSTA1 and GSTA2 expression.
11668220 2001 Polymorphism of human Alpha class glutathione transferases.
11550208 2001 GSTA1 expression in normal, preneoplastic, and neoplastic human prostate tissue.
11535243 2001 The role of human glutathione S-transferases (hGSTs) in the detoxification of the food-derived carcinogen metabolite N-acetoxy-PhIP, and the effect of a polymorphism in hGSTA1 on colorectal cancer risk.
11152686 2001 The role of glutathione in the isomerization of delta 5-androstene-3,17-dione catalyzed by human glutathione transferase A1-1.
10791551 2000 A marker for hepatocellular damage.
10213291 1999 Glutathione S-transferase Alpha 1-1 and aminotransferases in umbilical cord blood.
10053036 1999 Variability of glutathione S-transferase alpha in human liver and plasma.
9503014 1998 Fine mapping of the autosomal recessive polycystic kidney disease locus (PKHD1) and the genes MUT, RDS, CSNK2 beta, and GSTA1 at 6p21.1-p12.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8598105 1996 Sandwich ELISA for glutathione S-transferase Alpha 1-1: plasma concentrations in controls and in patients with gastrointestinal disorders.
8591048 1995 Structural analysis of human alpha-class glutathione transferase A1-1 in the apo-form and in complexes with ethacrynic acid and its glutathione conjugate.
8431482 1993 Characterization of two novel subunits of the alpha-class glutathione S-transferases of human liver.
8331657 1993 Structure determination and refinement of human alpha class glutathione transferase A1-1, and a comparison with the Mu and Pi class enzymes.
8307579 1993 Structure and organization of the human alpha class glutathione S-transferase genes and related pseudogenes.
8242618 1993 Immunohistochemical localization of glutathione S-transferases in human lung.
8185623 1994 Structure and function of the 5' flanking sequences of the human alpha class glutathione S-transferase genes.
7888077 1994 Gene structure and regulation of expression of human glutathione S-transferases alpha.
3800996 1986 Human liver glutathione S-transferases: complete primary sequence of an Ha subunit cDNA.
3678589 1987 Nucleotide sequence of the human liver glutathione S-transferase subunit 1 cDNA.
3138230 1988 Human glutathione S-transferases. The Ha multigene family encodes products of different but overlapping substrate specificities.
3036131 1987 The basic glutathione S-transferases from human livers are products of separate genes.
3031680 1987 Isolation of a cDNA clone and localization of human glutathione S-transferase 2 genes to chromosome band 6p12.
2604726 1989 Evidence that glutathione S-transferases B1B1 and B2B2 are the products of separate genes and that their expression in human liver is subject to inter-individual variation. Molecular relationships between the B1 and B2 subunits and other Alpha class glutathione S-transferases.
2018473 1991 The contribution of the C-terminal sequence to the catalytic activity of GST2, a human alpha-class glutathione transferase.
1731620 1992 Isolation and characterization of a human glutathione S-transferase Ha1 subunit gene.
1530570 1992 Purification and characterization of eight glutathione S-transferase isoenzymes of hamster. Comparison of subunit composition of enzymes from liver, kidney, testis, pancreas and trachea.
1330133 1992 Heterologous expression of recombinant human glutathione transferase A1-1 from a hepatoma cell line.