Property Summary

Ligand Count 11
NCBI Gene PubMed Count 198
PubMed Score 243.28
PubTator Score 287.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -2.936 2.3e-02
aldosterone-producing adenoma -3.318 2.0e-02
Breast cancer -1.600 4.0e-09
colon cancer -1.800 4.9e-02
cystic fibrosis 3.000 2.5e-05
diabetes mellitus 1.100 1.3e-03
head and neck cancer and chronic obstruc... -1.200 1.2e-02
intraductal papillary-mucinous adenoma (... -2.000 4.8e-03
intraductal papillary-mucinous carcinoma... -2.800 1.1e-02
intraductal papillary-mucinous neoplasm ... -3.600 4.9e-03
lung carcinoma -1.200 3.0e-03
nasopharyngeal carcinoma -4.100 9.6e-07
nephrosclerosis -2.038 3.8e-02
non-small cell lung cancer 1.745 1.2e-03
pancreatic cancer -2.200 7.1e-04
primary pancreatic ductal adenocarcinoma -1.471 1.4e-02
psoriasis -1.600 7.8e-12
ulcerative colitis -1.500 3.5e-03

Synonym

Accession P08263 Q14750 Q5GHF8 Q5SZC1
Symbols GST2
GTH1
GSTA1-1
GST-epsilon

Gene

PDB

1LBK   1GSD   1GSE   1GSF   1GUH   1K3L   1K3O   1K3Y   1PKW   1PKZ   1PL1   1PL2   1USB   1XWG   1YDK   2R3X   2R6K   3I69   3I6A   3IK9   3KTL   3L0H   3Q74   3U6V   3ZFB   3ZFL   4HJ2   5JCU   5LCZ   5LD0  

Protein-protein Interaction (5)

Gene RIF (182)

AA Sequence

MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRA      1 - 70
ILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVL     71 - 140
KSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDE    141 - 210
KSLEEARKIFRF                                                              211 - 222
//

Text Mined References (200)

PMID Year Title