Property Summary

Ligand Count 11
NCBI Gene PubMed Count 198
PubMed Score 243.28
PubTator Score 287.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -2.936 2.3e-02
aldosterone-producing adenoma -3.318 2.0e-02
Breast cancer -1.600 4.0e-09
colon cancer -1.800 4.9e-02
cystic fibrosis 3.000 2.5e-05
diabetes mellitus 1.100 1.3e-03
head and neck cancer and chronic obstruc... -1.200 1.2e-02
intraductal papillary-mucinous adenoma (... -2.000 4.8e-03
intraductal papillary-mucinous carcinoma... -2.800 1.1e-02
intraductal papillary-mucinous neoplasm ... -3.600 4.9e-03
lung carcinoma -1.200 3.0e-03
nasopharyngeal carcinoma -4.100 9.6e-07
nephrosclerosis -2.038 3.8e-02
non-small cell lung cancer 1.745 1.2e-03
pancreatic cancer -2.200 7.1e-04
primary pancreatic ductal adenocarcinoma -1.471 1.4e-02
psoriasis -1.600 7.8e-12
ulcerative colitis -1.500 3.5e-03

Protein-protein Interaction (5)

PDB (30)

Gene RIF (182)

AA Sequence

MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRA      1 - 70
ILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVL     71 - 140
KSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDE    141 - 210
KSLEEARKIFRF                                                              211 - 222
//

Text Mined References (200)

PMID Year Title