Property Summary

NCBI Gene PubMed Count 41
PubMed Score 22.83
PubTator Score 23.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
acute quadriplegic myopathy 1.322 2.5e-06
aldosterone-producing adenoma -1.235 4.9e-02
astrocytic glioma 1.300 1.3e-02
breast carcinoma 1.500 1.0e-27
cystic fibrosis -1.200 6.9e-04
ductal carcinoma in situ 1.100 1.4e-04
ependymoma 1.200 1.4e-02
glioblastoma 1.300 4.3e-02
group 4 medulloblastoma 1.100 1.4e-03
hereditary spastic paraplegia -1.114 2.1e-02
intraductal papillary-mucinous adenoma (... 1.500 4.5e-03
intraductal papillary-mucinous carcinoma... 1.600 5.3e-03
invasive ductal carcinoma 1.400 8.6e-05
lung adenocarcinoma 1.277 1.5e-07
lung cancer -1.200 4.3e-03
medulloblastoma, large-cell 1.300 3.1e-04
Multiple myeloma 1.876 1.2e-03
non primary Sjogren syndrome sicca -1.100 1.4e-02
non-small cell lung cancer -1.059 3.1e-24
oligodendroglioma 1.800 1.8e-03
osteosarcoma -1.221 3.8e-02
ovarian cancer -2.000 2.4e-08
pediatric high grade glioma 1.100 9.3e-07
Pick disease 1.300 3.0e-04
primary pancreatic ductal adenocarcinoma 1.007 8.3e-03
progressive supranuclear palsy 1.300 4.6e-03
psoriasis 1.200 1.6e-42
tuberculosis -1.300 2.7e-07

 GWAS Trait (1)

Gene RIF (21)

AA Sequence

MELSEPIVENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKPKSVVAPPGAP      1 - 70
KKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTV     71 - 140
EVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTA    141 - 210
GVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYI    211 - 280
GLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDD    281 - 350
VETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCI    351 - 420
EEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGK    421 - 490
VLKLVPEKD                                                                 491 - 499
//

Text Mined References (45)

PMID Year Title