Property Summary

NCBI Gene PubMed Count 6
PubMed Score 18.94
PubTator Score 8.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

AA Sequence

MAAAAGGAASRRGAGRPCPFSIEHILSSLPERSLPARAACPPQPAGRQSPAKPEEPGAPEAAPCACCCCC      1 - 70
GPRAAPCGPPEAAAGLGARLAWPLRLGPAVPLSLGAPAGGSGALPGAVGPGSQRRTRRHRTIFSEEQLQA     71 - 140
LEALFVQNQYPDVSTRERLAGRIRLREERVEVWFKNRRAKWRHQKRASASARLLPGVKKSPKGSC         141 - 205
//

Text Mined References (6)

PMID Year Title