Property Summary

NCBI Gene PubMed Count 29
PubMed Score 147.60
PubTator Score 278.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Cryptophthalmos syndrome 3
Disease Target Count P-value
lung carcinoma 2844 1.2e-15
osteosarcoma 7933 1.8e-04
glioblastoma 5572 1.4e-03
pilocytic astrocytoma 3086 1.4e-03
adult high grade glioma 2148 4.9e-03
ductal carcinoma in situ 1745 4.4e-02
Disease Target Count
Fraser syndrome 3

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.332 1.8e-04
glioblastoma -1.300 1.4e-03
adult high grade glioma -1.300 4.9e-03
pilocytic astrocytoma -1.200 1.4e-03
lung carcinoma 2.600 1.2e-15
ductal carcinoma in situ 1.100 4.4e-02

Protein-protein Interaction (8)

Gene RIF (15)

PMID Text
25673849 the Trip6-GRIP1-myosin VI interaction and its regulation on F-actin network play a significant role in dendritic morphogenesis
24700879 In 15 of 590 families, we identified recessive mutations in the genes FRAS1, FREM2, GRIP1, FREM1, ITGA8, and GREM1, all of which function in the interaction of the ureteric bud and the metanephric mesenchyme.
22510445 In three unrelated families with parental consanguinity, GRIP1 mutations were found to segregate with Fraser syndrome in an autosomal recessive manner.
21383172 Gain-of-function glutamate receptor interacting protein 1 variants alter GluA2 recycling and surface distribution in patients with autism
20877300 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19736351 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
18315564 GRIP1 splice forms interact with gephyrin and play a role in synaptic function at GABAergic and glycinergic synapses in cultured hippocampal neurons.
18155042 Supramodular nature of GRIP1 revealed by the structure of its PDZ12 tandem in complex with the carboxyl tail of Fras1.
17303296 Observational study of gene-disease association. (HuGE Navigator)
17303296 study showed neither single marker nor haplotype analysis revealed an association between variants at GRIP1 locus & schizophrenia; suggests it is unlikely that the GRIP1 polymorphisms investigated play a substantial role in schizophrenia susceptibility
15226318 GRIP1c 4-7 plays a role not only in glutamatergic synapses but also in GABAergic synapses
12011465 after regulated endocytosis, binding to GRIP/ABP stabilizes the internalized receptors in an intracellular pool and prevents them from being recycled back to the plasma membrane or entering a degradative pathway.

AA Sequence

MIAVSFKCRCQILRRLTKDESPYTKSASQTKPPDGALAVRRQSIPEEFKGSTVVELMKKEGTTLGLTVSG      1 - 70
GIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVS     71 - 140
VQGSSVIFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIR    141 - 210
LLGTTHAEAMSILKQCGQEAALLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTTSMCCNKQVIVI    211 - 280
DKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEILPHHQTRLALKGPDHVKI    281 - 350
QRSDRQLTWDSWASNHSSLHTNHHYNTYHPDHCRVPALTFPKAPPPNSPPALVSSSFSPTSMSAYSLSSL    351 - 420
NMGTLPRSLYSTSPRGTMMRRRLKKKDFKSSLSLASSTVGLAGQVVHTETTEVVLTADPVTGFGIQLQGS    421 - 490
VFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEASQLLRDSSITSKVTLEIEFD    491 - 560
VAESVIPSSGTFHVKLPKKHNVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIR    561 - 630
LDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITISGTEEPFDPIIIS    631 - 700
SLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSPKKFPISS    701 - 770
HLSDLGDVEEDSSPAQKPGKLSDMYPSTVPSVDSAVDSWDGSAIDTSYGTQGTSFQASGYNFNTYDWRSP    771 - 840
KQRGSLSPVTKPRSQTYPDVGLSYEDWDRSTASGFAGAADSAETEQEENFWSQALEDLETCGQSGILREL    841 - 910
EEKADRRVSLRNMTLLATIMSGSTMSLNHEAPTPRSQLGRQASFQERSSSRPHYSQTTRSNTLPSDVGRK    911 - 980
SVTLRKMKQEIKEIMSPTPVELHKVTLYKDSDMEDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDR    981 - 1050
LLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRNPLASQKSIDQQSLPGDWSEQNSAFFQQPSHGGNLE   1051 - 1120
TREPTNTL                                                                 1121 - 1128
//

Text Mined References (31)

PMID Year Title
25673849 2015 Trip6 promotes dendritic morphogenesis through dephosphorylated GRIP1-dependent myosin VI and F-actin organization.
24964207 2014 Genetic relationships between suicide attempts, suicidal ideation and major psychiatric disorders: a genome-wide association and polygenic scoring study.
24700879 2014 Mild recessive mutations in six Fraser syndrome-related genes cause isolated congenital anomalies of the kidney and urinary tract.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24488492 2014 The methyltransferase WBSCR22/Merm1 enhances glucocorticoid receptor function and is regulated in lung inflammation and cancer.
22510445 2012 Mutations in GRIP1 cause Fraser syndrome.
21383172 2011 Gain-of-function glutamate receptor interacting protein 1 variants alter GluA2 recycling and surface distribution in patients with autism.
20877300 2012 Genome-wide association study of increasing suicidal ideation during antidepressant treatment in the GENDEP project.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19736351 2009 Recurrent rearrangements in synaptic and neurodevelopmental genes and shared biologic pathways in schizophrenia, autism, and mental retardation.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18315564 2008 Gephyrin interacts with the glutamate receptor interacting protein 1 isoforms at GABAergic synapses.
18155042 2008 Supramodular nature of GRIP1 revealed by the structure of its PDZ12 tandem in complex with the carboxyl tail of Fras1.
17932106 2008 CBP Is a dosage-dependent regulator of nuclear factor-kappaB suppression by the estrogen receptor.
17635946 2007 A novel point mutation in helix 11 of the ligand-binding domain of the human glucocorticoid receptor gene causing generalized glucocorticoid resistance.
17545996 2007 Metabolism, cytoskeleton and cellular signalling in the grip of protein Nepsilon - and O-acetylation.
17303296 2007 No association of GRIP1 gene polymorphisms with schizophrenia in Chinese population.
16957778 2006 The catalytic subunit of the proteasome is engaged in the entire process of estrogen receptor-regulated transcription.
16541075 2006 The finished DNA sequence of human chromosome 12.
16362036 2006 The GRIP1:IRF3 interaction as a target for glucocorticoid receptor-mediated immunosuppression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16055064 2005 PICK1 interacts with ABP/GRIP to regulate AMPA receptor trafficking.
15769988 2005 A novel point mutation in the ligand-binding domain (LBD) of the human glucocorticoid receptor (hGR) causing generalized glucocorticoid resistance: the importance of the C terminus of hGR LBD in conferring transactivational activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15226318 2004 A four PDZ domain-containing splice variant form of GRIP1 is localized in GABAergic and glutamatergic synapses in the brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12011465 2002 Differential roles for NSF and GRIP/ABP in AMPA receptor cycling.
11641419 2001 The carboxyl terminus of the prolactin-releasing peptide receptor interacts with PDZ domain proteins involved in alpha-amino-3-hydroxy-5-methylisoxazole-4-propionic acid receptor clustering.
10197531 1999 EphrinB ligands recruit GRIP family PDZ adaptor proteins into raft membrane microdomains.