Property Summary

NCBI Gene PubMed Count 22
PubMed Score 9.38
PubTator Score 10.23

Knowledge Summary

Patent (2,951)

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.300 9.4e-03
group 3 medulloblastoma -2.000 6.0e-05
atypical teratoid/rhabdoid tumor -1.600 1.5e-06
medulloblastoma, large-cell -1.400 4.9e-04
lung carcinoma 1.500 5.7e-17
facioscapulohumeral dystrophy 2.600 8.7e-05

 CSPA Cell Line (3)

Protein-protein Interaction (1)

Gene RIF (9)

PMID Text
24916645 GRID1 expression is downregulated in both MECP2- and CDKL5-mutated iPS cells and upregulated in neuronal precursors and mature neurons.
23017809 GRID1 genotype is related to gray matter variation in prefrontal and anterior thalamic brain areas in healthy subjects, but not in schizophrenia patients, indicating a potential role in thalamo-cortical functioning.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19346103 The results of this study suggested that genetic variants in the GRID1 transcriptional regulatory region may play a role in the etiology of schizophrenia.
19346103 Observational study of gene-disease association. (HuGE Navigator)
17490860 Observational study of gene-disease association. (HuGE Navigator)
17490860 results strongly support previously reported association studies, implicating GRID1 in the etiology of schizophrenia
16380905 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEALTLWLLPWICQCVSVRADSIIHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKITYSIKVIEAN      1 - 70
NPFQAVQEACDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNPGGSPRTACHLNPSPDGEAYT     71 - 140
LASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQSFLDQASRLGLDVSLQKVDKNISHVFTSLFT    141 - 210
TMKTEELNRYRDTLRRAILLLSPQGAHSFINEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTV    211 - 280
VRQIFPSAKDNQKCTRNNHRISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLN    281 - 350
CIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKG    351 - 420
LNGSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPDG    421 - 490
RYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIKKPEEKISIFSLFAP    491 - 560
FDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASATLHSAIWIVYGAFVQQGGESSVNSMAM    561 - 630
RIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQVEMSYGTVRDSAVYEYFRAKGTNPLE    631 - 700
QDSTFAELWRTISKNGGADNCVSSPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGY    701 - 770
GIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWWPHMGRCDLTSHASAQADGKSLKLHSFAGVFCILAI    771 - 840
GLLLACLVAALELWWNSNRCHQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIELSALEMGGLAP    841 - 910
TQTLEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSATMPSMQCKHRSPNGGLFRQSP    911 - 980
VKTPIPMSFQPVPGGVLPEALDTSHGTSI                                             981 - 1009
//

Text Mined References (24)

PMID Year Title
24916645 2015 GluD1 is a common altered player in neuronal differentiation from both MECP2-mutated and CDKL5-mutated iPS cells.
24121790 2013 A genome-wide association study identifies new susceptibility loci for esophageal adenocarcinoma and Barrett's esophagus.
23726511 2013 Genome-wide association study identifies new susceptibility loci for posttraumatic stress disorder.
23568457 2013 Genetic variants associated with disordered eating.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
23180869 2014 Genome-wide association study of survival in patients with pancreatic adenocarcinoma.
23017809 2012 Glutamate receptor ? 1 (GRID1) genetic variation and brain structure in schizophrenia.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
19346103 2009 Dissection of phenotype reveals possible association between schizophrenia and Glutamate Receptor Delta 1 (GRID1) gene promoter.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17490860 2007 A case-control association study between the GRID1 gene and schizophrenia in the Chinese Northern Han population.
16380905 2005 Bipolar I disorder and schizophrenia: a 440-single-nucleotide polymorphism screen of 64 candidate genes among Ashkenazi Jewish case-parent trios.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12372286 2002 A novel protein complex linking the delta 2 glutamate receptor and autophagy: implications for neurodegeneration in lurcher mice.
11829466 2002 Identification of rat EMAP, a delta-glutamate receptor binding protein.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10234023 1999 Postsynaptic density-93 interacts with the delta2 glutamate receptor subunit at parallel fiber synapses.
9828146 1998 Mapping of the mouse glutamate receptor delta1 subunit (Grid1) to chromosome 14.
1372507 1992 Molecular cloning of a cDNA encoding a novel member of the mouse glutamate receptor channel family.