Property Summary

NCBI Gene PubMed Count 19
PubMed Score 590.68
PubTator Score 7.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.300 4.8e-03
posterior fossa group A ependymoma -1.900 7.2e-12
oligodendroglioma -1.200 9.7e-03
glioblastoma -2.300 1.3e-05
atypical teratoid / rhabdoid tumor -2.200 1.4e-07
primitive neuroectodermal tumor -1.900 2.6e-03
Atopic dermatitis -1.100 1.9e-02
colon cancer -2.100 7.4e-06
breast carcinoma -1.600 7.5e-05
adult high grade glioma -1.700 1.3e-03
sonic hedgehog group medulloblastoma -1.700 1.3e-03
pilocytic astrocytoma -1.800 6.1e-07
psoriasis -1.700 7.8e-46
Breast cancer -1.600 1.5e-02
invasive ductal carcinoma -2.397 5.7e-04
pituitary cancer -1.900 3.7e-03

Gene RIF (8)

PMID Text
26416033 mutations associated with tooth malformations
26239165 Gremlin 2 inhibits adipocyte differentiation through activation of Wnt/beta-catenin signaling
25443231 GREM2 variants have been identified in atrial fibrillation cohort studies, demonstrating abnormalities in cardiac excitation - supra ventricular tachycardia and atrial fibrillation.
23902946 The minor allele of rs4454537 is significantly associated with low bone density at the total hip of southern Chinese people. Our study further suggests GREM2 as a novel susceptibility gene for osteoporosis.
23437003 and that a genetic variant in the FMN2/GREM2 locus influences GREM2 expression in osteoblasts and thereby trabecular number and thickness as well as fracture risk.
23223679 Through regulation of bone morphogenetic protein signaling, GREM2 is required for cardiac laterality and atrial differentiation during embryonic development.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19626040 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEALVVTERKYLKS      1 - 70
DWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGL     71 - 140
DPPFRLKKIQKVKQCRCMSVNLSDSDKQ                                              141 - 168
//

Text Mined References (19)

PMID Year Title
26416033 2015 GREMLIN 2 Mutations and Dental Anomalies.
26239165 2015 Gremlin 2 inhibits adipocyte differentiation through activation of Wnt/?-catenin signaling.
25443231 2014 Risk factors and genetics of atrial fibrillation.
23902946 2013 Genetic variants in GREM2 are associated with bone mineral density in a southern Chinese population.
23437003 2013 Genetic determinants of trabecular and cortical volumetric bone mineral densities and bone microstructure.
23223679 2013 Functional modeling in zebrafish demonstrates that the atrial-fibrillation-associated gene GREM2 regulates cardiac laterality, cardiomyocyte differentiation and atrial rhythm.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
22199011 2012 Association between chromosome 9p21 variants and the ankle-brachial index identified by a meta-analysis of 21 genome-wide association studies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19626040 2009 Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis.
17029022 2006 Bone morphogenetic proteins and their antagonists.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15621726 2004 Bone morphogenetic proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254711 2004 Identification and characterization of human CKTSF1B2 and CKTSF1B3 genes in silico.
15039429 2004 Protein related to DAN and cerberus is a bone morphogenetic protein antagonist that participates in ovarian paracrine regulation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14525956 2004 Comparative genomic analysis of the eight-membered ring cystine knot-containing bone morphogenetic protein antagonists.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.