Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50
PubTator Score 1.00

Knowledge Summary


No data available


  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.500 4.2e-02
posterior fossa group B ependymoma 2.300 2.9e-07
cutaneous lupus erythematosus -1.500 1.1e-03
osteosarcoma 1.004 2.1e-02
atypical teratoid / rhabdoid tumor 1.200 9.8e-03
adrenocortical carcinoma 1.145 3.2e-02
sonic hedgehog group medulloblastoma 1.800 1.3e-03
lung carcinoma 1.100 8.2e-19
Breast cancer 1.700 5.8e-05
ovarian cancer 1.300 1.6e-08
psoriasis -1.900 3.8e-40


Accession Q9C091 A4QN17 Q9H8F1
Symbols C18orf6


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

ELEDEWQFRLRDEFQTANSSDDKPLYFLTGRHV                                        1891 - 1923

Text Mined References (6)

PMID Year Title
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.