Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.57
PubTator Score 0.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma 1.900 4.7e-02
ependymoma 2.400 2.7e-02
group 3 medulloblastoma -3.000 2.7e-06
atypical teratoid/rhabdoid tumor -2.400 3.6e-05
medulloblastoma, large-cell -3.700 6.6e-08
primitive neuroectodermal tumor -1.800 1.6e-02
adrenocortical carcinoma -1.811 1.4e-03
tuberculosis and treatment for 3 months -1.100 9.5e-05
intraductal papillary-mucinous adenoma (... 1.400 3.1e-03
intraductal papillary-mucinous neoplasm ... 1.800 6.0e-03
colon cancer -1.300 7.1e-03
breast carcinoma -1.400 1.7e-21
interstitial cystitis -1.100 3.1e-04
lung adenocarcinoma 1.444 1.6e-04
Breast cancer -2.200 7.9e-21
ulcerative colitis -1.400 9.4e-06
ovarian cancer -1.500 3.4e-04
pituitary cancer -1.900 1.9e-03
Down syndrome 2.100 3.2e-04

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTELQQDVEDTKPAKVLGKRESKLGSAHSEAENGVEEKKKACRSPTAQSPTPSVEADSPDQKKIISLWSK      1 - 70
SSFDGASLASDKNDCKTESKNDPKTERKKSSSSSQYKANMHFHKLFLSVPTEEPLKQSFTCALQKEILYQ     71 - 140
GKLFVSENWICFHSKVFGKDTKISIPAFSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKLL    141 - 210
KSVCGHLENTSVGNSPNPSSAENSFRADRPSSLPLDFNDEFSDLDGVVQQRRQDMEGYSSSGSQTPESEN    211 - 280
SRDFHATESQTVLNVSKGEAKPTRADAHVNRVPEGKAKSLPVQGLSETVGILHKVKSQKCPMLHHILIFY    281 - 350
AIVVCALIISTFYMRYRINTLEEQLGLLTSIVDTHNTEQAAPSGLRSQVQFNVEVLCQELTANIVKLEKI    351 - 420
QNNLQKLLENGD                                                              421 - 432
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.