Property Summary

NCBI Gene PubMed Count 110
PubMed Score 265.17
PubTator Score 1624.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.100 3.5e-04
non-inflammatory breast cancer -1.300 4.3e-02
psoriasis -1.600 1.8e-29

 IMPC Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (94)

PMID Text
26791408 Liver fat content and serum ALT were inversely correlated with bone mineral density in middle-aged and elderly men.
26791191 Data suggest that, in context of abnormal hepatic lipid accumulation in nonalcoholic fatty liver disease, circulating GPT1 rises due to up-regulation of hepatic expression of GPT1 associated with greater gluconeogenesis and insulin resistance.
26664483 Age, female gender, and elevated ALT can help identifying cases with biliary etiology of acute pancreatitis.
26632395 IBS [irritable bowel syndrome ] may be an important condition in certain patients with elevated ALT levels and MS [ metabolic syndrome ].
26446640 Elevated aminotransferase levels, even within the normal range, were significantly associated with increased risk of all external-cause mortalities, including suicide, and injury.
26290281 The serum hepcidin, ferritin, alanine transaminase, aspartate transaminase, gamma-glutamyltransferase and bilirubin were examined in two independent Chinese cohorts consisted of 3455 individuals.
26160405 There are significant relationships of elevated ALT levels with cardiometabolic risk factors (obesity, hypertension, hypercholesteremia, hyperuricemia, hypertriglyceridemia) and several sex-related differences in rural Chinese.
25874513 ALT was significantly associated with elevated levels of triacylglycerols, hyperglycemia, and obesity. In patients with metabolic syndrome, one must consider liver involvement if the patient has ALT levels in the upper third of the reference range.
25543901 Serum glutamate pyruvate transaminase levels were elevated postoperatively in recipients of an orthotopic liver transplant from a brain-dead donor receiving extracorporeal membrane oxygenation.
25437895 elevated serum ALT and GGT levels are associated with increased arterial stiffness, independent of the classical atherosclerotic risk factors in Japanese men
25272068 The aim of this study was to establish the reference intervals (RIs) of total bilirubin (TBIL), alanine aminotransferase (ALT), aspartate transaminase (AST), and creatinine (CREA) for apparently healthy elderly (Han ethnicity) in Shuyang, China.
25219834 Serum alanine aminotransferase has limited predictive value for liver disease in chronic hepatitis C
25145475 In nonalcoholic fatty liver disease, adipose tissue insulin resistance (but not hepatic insulin resistance) and liver triglyceride content are major factors in the elevation of plasma aminotransferase levels.
24953204 Alanine aminotransferase showed associations with BMI, glycaemia, lipids, and creatinine. The relationship between alanine aminotransferase and age was best expressed by polynomial regression.
24937007 Peginterferon alfa-2a is associated with elevations in alanine aminotransferase at the end of treatment in chronic hepatitis C patients with sustained virologic response.
24849491 Statistically significant differences were observed in the mean values of GPT in type 1 diabetics compared to type 2 and control groups
24819732 A prospective association between ALT levels and metabolic syndrome highlights the value of ALT levels, even mild ALT elevations within the normal range, as a predictor of the MetS risk in male schizophrenia patients.
24691744 PNPLA3 I148M polymorphism is associated with elevated alanine transaminase levels in Mexican indigenous and Mestizo populations.
24500143 ALT and visceral adipose tissue affect metabolic risk factors in a middle-aged Japanese population
24349501 Among patients with chronic HCV infection, daily consumption of filtered coffee may have a beneficial effect on the stabilization of ALT levels.
24324749 A new model that combines ALT, platelets, CK-18 fragments, and triglycerides was established by logistic regression among nonalcoholic fatty liver disease patients.
24275711 elevated ALT is common in the Korean population; it is associated with metabolic disorders (obesity, insulin resistance, or metabolic syndrome) in the majority of patients
24205292 fibrosis is not rare in Chinese CHB patients with persistent normal alanine aminotransferase, especially HBeAg-positive patients over 30 years old
24158044 Elevated serum ALT levels are prevalent among elderly agricultural and fishing population workers in Taiwan.
23884827 Role of insulin resistance and adipocytokines on serum alanine aminotransferase in obese patients with type 2 diabetes mellitus
23880909 Elevated serum alanine aminotransferase level was independently associated with an increased risk of intracerebral hemorrhage in East Asian men.
23794308 Normal to near-normal serum aminotransferase levels are associated with metabolic disorders.
23667618 Alcohol consumption, smoking status, and metabolic syndrome impact on serum levels of aspartate aminotransferase (AST), alanine aminotransferase (ALT), and gamma-glutamyl transferase (GGT), was determined.
23522007 Elevated ALT is associated with developing depressive symptoms, suggesting that non-alcoholic fatty liver disease may represent an independent modifiable risk factor for depression.
23403445 Data from cross-sectional study in children/adolescents in Republic of Korea suggest normal ALT/GPT serum reference values; ALT/GPT serum level appears effective as biomarker in predicting cardiovascular/metabolic syndrome risk in population studied.
23384374 Among HIV/HCV-coinfected persons, risky drinking was associated with a higher adjusted mean AST (62.2 vs. 51.4 U/L; adjusted ratio of means 1.2, 95% CI [1.07, 1.37], p = .003) and ALT (51.3 vs. 41.6 U/L; compared with non-risky drinking
23119080 Data indicate that ferritin levels and hyperuricemia are two independently significant factors associated with alanine aminotransferase (ALT) elevation among obese adolescents.
22975640 Nonalcoholic fatty liver disease and metabolic syndrome were associated with ALT levels in a male population from southern China.
22954960 ALT[Alanine transaminase] may be a marker of an underlying etiology relating to the paradoxical associations of diabetes and IHD at a population level.
22389715 An elevated ALT does not accurately predict significant liver injury. Decisions on commencing antiviral therapy should not be heavily based on a particular ALT threshold.
22357454 Patients with HLA-DQA1 and DRB1 genotypes have higher alanine aminotransferase elevation, whereas HLA-negative cases have a higher incidence of Gilbert's syndrome.
22352690 APRI and AST/ALT are independent predictors for significant fibrosis in chronic hepatitis C patients.
22293393 the COMT polymorphism affects serum ALT activity to maintain liver function
22242166 This study highlights the necessity of intensive follow-up for those with elevated AST and ALT levels and comorbid alcohol use disorder for preventing excessive natural deaths.
22177542 In a cross-sectional study, Chinese adolescents and young adults with more metabolic syndrome components were more likely to suffer from elevated ALT
22158663 alanine aminotransferase levels largely within the normal range, there was an inverse association between ALT and all-cause mortality and cardiovascular events
22140488 The magnitude of the association of PNPLA3 with liver enzymes is driven by the size of abdominal fat.
22132177 The patterns of interaction between smoking and alcohol consumption or BMI with respect to AST and ALT resembled those observed for gamma-GT.
21987480 discriminates persons infected with hepatitis C virus from those at low risk of liver disease, but would be considered elevated in a large proportion of the U.S. population
21720553 The prevalence of metabolic syndrome (MS) and risk factors for and association with elevated alanine aminotransferase (ALT) as markers of hepatic injury in a large Hispanic health disparity cohort with high rates of obesity, was studied.
21715038 In a cross-sectional analysis of Taiwanese industrial employees, elevated ALT associated with MS, but in subjects who did not meet MS criteria, elevated ALT by itself did not associate with IFG/T2DM.
21692932 An hepatitis B virus DNA level of >/=5 log10 copies/mL and an alanine aminotransferase (ALT) level of >20 to </=40 IU/L were independent predictors of hepatitis reactivation in a Cox model.
21199427 Study confirmed significant and independent associations of GGT and ALT with MetS in adult Chinese people.
21040936 Subjects with metabolic syndrome had significantly higher plasma levels of alanine aminotransferase.
20972737 liver enzymes, especially ALT, were significantly associated with IR according to direct clamp assessment, which were independent of the traditional risk factors in diabetic patients
20961180 Nrmal levels of ALT are associated with metabolic and androgenic phenotypes, i women of reproductive age.
20872970 Data suggest that serum alanine aminotransferase is inadequate for diagnosing lamivudine resistance and has implications where viral resistance testing is suboptimal and for reimbursement of rescue therapy.
20433554 Lowering the ALT upper normal reference limit will facilitate earlier detection of risky phenotypes of obesity.
20387481 Chronic hepatitis B patients with high non-specific cytotoxic T-Lymphocytes also has the high ALT level.
20205615 The association of coffee and green tea consumption with serum activities of liver enzymes in free-living Japanese men and women was examined, focusing on sex difference and effect modifications of alcohol and obesity.
20190678 No significant relationship between serum hepatitis B virus DNA level and liver histological stage, gender, age, body mass index, or hepatitis B surface antigen was observed in these patients with normal ALT.
20032584 elevation in GPT in obese children most likely reflects insulin resistance
19938201 Obesity and elevated ALT are associated with insulin resistance
19687577 All metabolic syndrome-related risk factors are significantly correlated with the increase in blood levels of alanine aminotransferase in a population of Japanese men and women.
19393479 the management of patients with pyelonephritis should take into account that moderate and self-limited abnormalities in aminotransferase levels are frequent during the acute phase of the disease
19370784 Results suggest that alanine and aspartate aminotransferase levels and AST/ALT ratio do not seem to be reliable predictors for non-alcoholic steatohepatitis.
19360321 A clinical method for selective measurement of ALT1 and 2 in human plasma is described.
19303161 approximately 60% of the variation in S-ALT, a marker of liver fat content, is genetically determined
19232448 High ALT level and low platelet count are closely associated with the development of hepatocarcinogenesis in hepatitis C carrirs. who are thus candidates for antiviral agents.
19217453 A high proportion of obese children present elevated ALT1 levels.
19159884 alanine aminotransferase may have a role in progression of cardiovascular disease and diabetes in Koreans
19100265 In the US population, elevated gamma-glutamyltransferase (GGT) was associated with mortality from all causes, liver disease, cancer, and diabetes, while alanine aminotransferase (ALT) was associated only with liver disease mortality.
19065605 Serum levels are an independent risk factor for the development of type 2 diabetes mellitus in subjects without fatty liver or hepatic dysfunction.
19012630 Neither ALT nor GGT concentrations were correlated with ALP concentration, but AST concentration was moderately correlated with ALP concentration.
18774966 HEV markers (HEV RNA and anti-HEV) were detected in donors with elevated ALT levels who were widely distributed over Japan
18763311 found a strong relationship between alanine aminotransferase levels and metabolic syndrome in metabolic syndrome
18708042 Alanine aminotransferase, alanine/aspartate aminotransferase ratio, and gamma-glutamyl transferase are associated with the MetS but not with angiographically determined coronary atherosclerosis.
18508279 Tag-free ALT1 and ALT2 were obtained by cleavage of enterokinase digestion and used for initial characterization of the enzymes. The specific ALT activity of purified fusion or His-tag-removed ALT1 was about 15-fold higher than that of ALT2
18473412 Non-alcoholic fatty liver disease is the most common cause of persistently elevated serum alanine aminotransferase level among the general population of Iran.
18432999 Observational study of genotype prevalence. (HuGE Navigator)
18315552 Raised ALT is common in apparently healthy British South Asians, and is significantly associated with an adverse metabolic and atherothrombotic risk profile.
18242760 Data revealed higher alanine aminotransferase for women with a family history of diabetes, when adjusted for age and BMI.
18178283 ALAT elevations associate with obesity and diabetes, and provide new evidence that in elderly male patients, ALAT elevations, absent other known liver diseases, may selectively associate with diabetes
18090161 In obese patients with NAFLD (nonalcoholic fatty liver disease), OSA (obstructive sleep apnea) was associated with elevated alanine aminotransferase levels and a trend toward histologic evidence of progressive liver disease.
17934148 Type 2 diabetic patients have 80% more liver fat than age-, weight-, and sex-matched nondiabetic subjects, which is underestimated in type 2 diabetics.
17907318 Abnormal serum aminotransferase values are uncommon in severely obese children in France.
17907292 In hepatitis C, alterations in the liver tissue as reflected by ALT elevation are mainly associated with periportal bridging/necrosis, viral load and duration of disease.
17877759 PTLP activity is positively associated with serum ALT1, GOT1 and GOT2 in type 2 diabetes mellitus and metabolic syndrome.
17766001 Weight reduction secondary to a hypocaloric diet were associated with improvement in hypertransaminasemia and insulin resistance in nonalcoholic fatty liver disease.
17764776 May serve as a useful marker for non-alcoholic fatty liver disease or diabetes risk in Filipino women.
17570354 Data show that OCT/ALT is a potent indicator for the diagnosis and the prognosis of hepatocellular carcinoma.
17405346 Insulin resistance in obese patients is associated with alanine aminotransferase activity.
17378732 Provides a quantitative analysis of the main impact of the trauma of liver resection, liver ischemia, and other factors on the postoperative evolution of transaminases.
17134955 In obesity, elevated ALT activity is associated with increased fasting insulin suggesting that insulin resistance, rather than body mass index alone, plays a role in mediating the increased aminotransferase activity.
16652026 In coinfected Hic/hepatitis C patients, normal ALT levels are not an indicator of mild necroinflammation and may not portend a more benign disease course.
15306699 mildly elevated in severe acute respiratory syndrome patients during second week after onset of fever.
14506613 genotypes of aldehyde dehydrogenase 2 and beta3-adrenergic receptor were strongly associated with elevated alanine aminotransferase level which increased with the accumulation of components of metabolic syndrome
12774006 Histology of nonalcoholic fatty liver disease in individuals with normal ALT values, not significantly different from those with elevated ALT levels, and low normal value does not guarantee freedom from steatohepatitis with advanced fibrosis.
12480555 Glucose intolerance is associated with elevated serum aminotransferase independent of obesity, but even a mildly elevated ALT is relatively uncommon in free-living men with glucose intolerance.

AA Sequence

MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGD      1 - 70
AQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYI     71 - 140
ERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDE    141 - 210
ERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVY    211 - 280
AAGSQFHSFKKVLMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCP    281 - 350
PVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQL    351 - 420
PPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAK    421 - 490
FTLEYS                                                                    491 - 496
//

Text Mined References (112)

PMID Year Title
26791408 2016 The association of liver fat content and serum alanine aminotransferase with bone mineral density in middle-aged and elderly Chinese men and postmenopausal women.
26791191 2016 Serum aminotransferases in nonalcoholic fatty liver disease are a signature of liver metabolic perturbations at the amino acid and Krebs cycle level.
26664483 Clinico-biochemical factors to early predict biliary etiology of acute pancreatitis: age, female gender, and ALT.
26632395 2016 Irritable Bowel Syndrome May Be Associated with Elevated Alanine Aminotransferase and Metabolic Syndrome.
26477546 2015 Joubert Syndrome in French Canadians and Identification of Mutations in CEP104.
26446640 2015 Elevation of Serum Aminotransferase Levels and Future Risk of Death from External Causes: A Prospective Cohort Study in Korea.
26290281 2015 Elevated serum transaminase activities were associated with increased serum levels of iron regulatory hormone hepcidin and hyperferritinemia risk.
26160405 2015 Association between elevated serum alanine aminotransferase and cardiometabolic risk factors in rural Chinese population: a cross-sectional study.
25874513 2015 Redefining the alanine aminotransferase upper limit of normal improves the prediction of metabolic syndrome risk.
25543901 2014 Marked elevation of hepatic transaminases in recipients of an orthotopic liver transplant from a brain-dead donor receiving extracorporeal membrane oxygenation.
25437895 2015 Relationships of elevated levels of serum hepatic enzymes and alcohol intake with arterial stiffness in men.
25272068 2014 Reference intervals for total bilirubin, ALT, AST and creatinine in healthy Chinese elderly.
25219834 2014 Serum alanine aminotransferase has limited predictive value for liver disease in chronic hepatitis C.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25145475 2015 The role of liver fat and insulin resistance as determinants of plasma aminotransferase elevation in nonalcoholic fatty liver disease.
24953204 2014 Determinants of alanine aminotransferase levels in a large population from Southern Italy: relationship between alanine aminotransferase and age.
24937007 2014 Peginterferon alfa-2a is associated with elevations in alanine aminotransferase at the end of treatment in chronic hepatitis C patients with sustained virologic response.
24849491 2014 A comparative study of glutamate oxaloacetate transaminase (GOT) and glutamate pyruvate transaminase (GPT) levels in the saliva of diabetic and normal patients.
24819732 2014 Aminotransferase levels as a prospective predictor for the development of metabolic syndrome in patients with schizophrenia.
24691744 2014 PNPLA3 I148M polymorphism is associated with elevated alanine transaminase levels in Mexican Indigenous and Mestizo populations.
24500143 2014 Relationships between alanine aminotransferase (ALT), visceral adipose tissue (AT) and metabolic risk factors in a middle-aged Japanese population.
24349501 2013 Effect of caffeine-containing beverage consumption on serum alanine aminotransferase levels in patients with chronic hepatitis C virus infection: a hospital-based cohort study.
24324749 2013 Cytokeratin 18, alanine aminotransferase, platelets and triglycerides predict the presence of nonalcoholic steatohepatitis.
24275711 2014 The prevalence of elevated alanine transaminase and its possible causes in the general Korean population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24205292 2013 Significant fibrosis is not rare in Chinese chronic hepatitis B patients with persistent normal ALT.
24158044 2014 Clinical implications in the prevalence and associated cardiovascular factors of elevated serum alanine aminotransferase levels among elderly agricultural and fishing population in Taipei, Taiwan: experience at a teaching hospital.
23884827 2013 Role of insulin resistance and adipocytokines on serum alanine aminotransferase in obese patients with type 2 diabetes mellitus.
23880909 2013 Association between alanine aminotransferase and intracerebral hemorrhage in East Asian populations.
23794308 2012 Relationship between serum aminotransferase levels and metabolic disorders in northern China.
23667618 2013 Independent and supra-additive effects of alcohol consumption, cigarette smoking, and metabolic syndrome on the elevation of serum liver enzyme levels.
23522007 2013 Elevated alanine aminotransferase independently predicts new onset of depression in employees undergoing health screening examinations.
23403445 2013 Healthy range of serum alanine aminotransferase and its predictive power for cardiovascular risk in children and adolescents.
23384374 2013 Risky alcohol use and serum aminotransferase levels in HIV-infected adults with and without hepatitis C.
23119080 2012 Hyperferritinemia and hyperuricemia may be associated with liver function abnormality in obese adolescents.
22975640 2012 Combinative analysis of factors influence serum alanine aminotransferase activity in adult male population from southern China.
22954960 2012 Alanine transaminase has opposite associations with death from diabetes and ischemic heart disease in NHANES III.
22389715 2012 A large population histology study showing the lack of association between ALT elevation and significant fibrosis in chronic hepatitis B.
22357454 2012 Lapatinib-induced liver injury characterized by class II HLA and Gilbert's syndrome genotypes.
22352690 2012 Association of genetic polymorphism -670A>G in the Fas gene and serum markers AST platelet ratio index, AST/ALT with significant fibrosis and cirrhosis in chronic hepatitis C.
22293393 2012 Association between the catechol-O-methyltransferase (rs4680: Val158Met) polymorphism and serum alanine aminotransferase activity.
22242166 2012 Elevated aspartate and alanine aminotransferase levels and natural death among patients with methamphetamine dependence.
22177542 2012 Higher waist-to-height ratio and waist circumference are predictive of metabolic syndrome and elevated serum alanine aminotransferase in adolescents and young adults in mainland China.
22158663 2011 The inverse relationship between alanine aminotransferase in the normal range and adverse cardiovascular and non-cardiovascular outcomes.
22140488 2011 The association of PNPLA3 variants with liver enzymes in childhood obesity is driven by the interaction with abdominal fat.
22132177 2011 Liver enzymes: interaction analysis of smoking with alcohol consumption or BMI, comparing AST and ALT to ?-GT.
21987480 2012 Upper limits of normal for alanine aminotransferase activity in the United States population.
21720553 2011 Prevalence of metabolic syndrome and risks of abnormal serum alanine aminotransferase in Hispanics: a population-based study.
21715038 2011 Elevated alanine aminotransferase is associated with metabolic syndrome but not consistently associated with impaired fasting glucose or type 2 diabetes mellitus.
21692932 2011 Viral level is an indicator of long-term outcome of hepatitis B virus e antigen-negative carriers with persistently normal serum alanine aminotransferase levels.
21199427 2011 Cross-sectional and longitudinal association of serum alanine aminotransaminase and ?-glutamyltransferase with metabolic syndrome in middle-aged and elderly Chinese people.
21040936 2011 The association between the metabolic syndrome and alanine amino transferase is mediated by insulin resistance via related metabolic intermediates (the Cohort on Diabetes and Atherosclerosis Maastricht [CODAM] study).
20972737 2010 Positive correlations of liver enzymes with metabolic syndrome including insulin resistance in newly diagnosed type 2 diabetes mellitus.
20961180 2010 Variations in alanine aminotransferase levels within the normal range predict metabolic and androgenic phenotypes in women of reproductive age.
20872970 2010 Alanine aminotransferase is an inadequate surrogate marker for detecting lamivudine resistance.
20433554 2010 Higher levels of alanine aminotransferase within the reference range predict unhealthy metabolic phenotypes of obesity in normoglycemic first-degree relatives of patients with type 2 diabetes mellitus.
20387481 2009 [Relations between ALT level and count of HBV special CTL and non-specific CTL in patients with chronic hepatitis B].
20205615 2010 Relation of coffee consumption and serum liver enzymes in Japanese men and women with reference to effect modification of alcohol use and body mass index.
20190678 2010 Relationship between serum HBV DNA level and liver histology in HBV carriers with normal ALT in Guilan province, Iran.
20032584 2009 Usefulness of GPT for diagnosis of metabolic syndrome in obese Japanese children.
19938201 2009 A better parameter in predicting insulin resistance: obesity plus elevated alanine aminotransferase.
19687577 2009 Prevalence of metabolic syndrome increases with the increase in blood levels of gamma glutamyltransferase and alanine aminotransferase in Japanese men and women.
19393479 2009 Abnormalities in aminotransferase levels during acute pyelonephritis.
19370784 2009 Non-alcoholic steatohepatitis with normal aminotransferase values.
19360321 2009 Detection of the mitochondrial and catalytically active alanine aminotransferase in human tissues and plasma.
19303161 2009 Genetic factors contribute to variation in serum alanine aminotransferase activity independent of obesity and alcohol: a study in monozygotic and dizygotic twins.
19232448 2009 Incidence of hepatocellular carcinoma in hepatitis C carriers with normal alanine aminotransferase levels.
19217453 2009 Association of elevated serum alanine aminotransferase with metabolic factors in obese children: sex-related analysis.
19159884 2009 Elevated alanine aminotransferase levels predict mortality from cardiovascular disease and diabetes in Koreans.
19100265 2009 Elevated serum alanine aminotransferase and gamma-glutamyltransferase and mortality in the United States population.
19065605 2009 Association of serum gamma-glutamyltransferase and alanine aminotransferase activities with risk of type 2 diabetes mellitus independent of fatty liver.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19012630 2008 The population distributions, upper normal limits and correlations between liver tests among Australian adolescents.
18774966 2008 A nationwide survey for hepatitis E virus prevalence in Japanese blood donors with elevated alanine aminotransferase.
18763311 2008 Relationship between alanine aminotransferase levels and metabolic syndrome in nonalcoholic fatty liver disease.
18708042 2008 Alanine aminotransferase and gamma-glutamyl transferase are associated with the metabolic syndrome but not with angiographically determined coronary atherosclerosis.
18508279 2008 Expression, purification, and initial characterization of human alanine aminotransferase (ALT) isoenzyme 1 and 2 in High-five insect cells.
18473412 2008 Persistent alanine aminotransferase elevation among the general Iranian population: prevalence and causes.
18432999 Typing classical polymorphisms by real-time PCR: analysis of the GPT and ALAD protein polymorphisms in the Jewish populations.
18315552 2008 Alanine aminotransferase is associated with atherothrombotic risk factors in a British South Asian population.
18242760 2008 Elevated liver enzymes in women with a family history of diabetes.
18178283 2008 Association of elevated alanine aminotransferase with BMI and diabetes in older veteran outpatients.
18090161 Liver enzymes and histology in obese patients with obstructive sleep apnea.
17934148 2008 Liver fat is increased in type 2 diabetic patients and underestimated by serum alanine aminotransferase compared with equally obese nondiabetic subjects.
17907318 2006 Insulin resistance and ferritin as major determinants of abnormal serum aminotransferase in severely obese children.
17907292 2007 Clinical significance of activity of ALT enzyme in patients with hepatitis C virus.
17877759 2008 Phospholipid transfer protein activity is determined by type 2 diabetes mellitus and metabolic syndrome, and is positively associated with serum transaminases.
17766001 2008 Effect of a hypocaloric diet in transaminases in nonalcoholic fatty liver disease and obese patients, relation with insulin resistance.
17764776 2008 Probable NAFLD, by ALT levels, and diabetes among Filipino-American women.
17570354 2007 Ratio of serum ornithine carbamoyltransferase to alanine aminotransferase as a potent indicator for hepatocellular carcinoma.
17405346 Influence of insulin resistance in obese patients on elevated serum alanine aminotransferase.
17378732 2007 Analysis of the components of hypertransaminasemia after liver resection.
17134955 2007 Aminotransferase activity in morbid and uncomplicated obesity: predictive role of fasting insulin.
16652026 2006 HIV/hepatitis C virus-coinfected patients with normal alanine aminotransferase levels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15306699 2004 Sequential changes of serum aminotransferase levels in patients with severe acute respiratory syndrome.
14506613 2003 Aldehyde dehydrogenase 2 and beta3-adrenergic receptor gene polymorphisms: their association with elevated liver enzymes and metabolic syndrome.
12774006 2003 Clinical and histologic spectrum of nonalcoholic fatty liver disease associated with normal ALT values.
12480555 2003 Glucose intolerance and serum aminotransferase activities in Japanese men.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12358155 2002 Screening the proteins that interact with calpain in a human heart cDNA library using a yeast two-hybrid system.
11863375 2002 cDNA cloning, genomic structure, chromosomal mapping, and functional expression of a novel human alanine aminotransferase.
9119391 1997 Human glutamate pyruvate transaminase (GPT): localization to 8q24.3, cDNA and genomic sequences, and polymorphic sites.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7361762 1980 Absence of red cell glutamic-pyruvate transaminase: discovery of a "silent" allele homozygote.
7114791 1982 Regulation of expression of liver-specific enzymes. II. Activation and chromosomal localization of soluble glutamate-pyruvate transaminase.
7114790 1982 Assignment of the gene for cytosolic alanine aminotransferase (AAT1) to human chromosome 8.
5581908 1971 Polymorphism of soluble glutamic-pyruvic transaminase: a new genetic marker in man.
3192219 1988 Gene dosage evidence for the regional assignment of GPT (glutamate-pyruvate transaminase; E.C. 2.6.1.2) locus to 8q24.2----8qter.
1931970 1991 Complete amino acid sequence of human liver cytosolic alanine aminotransferase (GPT) determined by a combination of conventional and mass spectral methods.
49232 1975 Genetics of the GPT system. Family, mother/child and association studies.