Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.13
PubTator Score 7.01

Knowledge Summary

Patent (2,214)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1683 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.0

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.200 1.4e-03

AA Sequence

MACNSTSLEAYTYLLLNTSNASDSGSTQLPAPLRISLAIVMLLMTVVGFLGNTVVCIIVYQRPAMRSAIN      1 - 70
LLLATLAFSDIMLSLCCMPFTAVTLITVRWHFGDHFCRLSATLYWFFVLEGVAILLIISVDRFLIIVQRQ     71 - 140
DKLNPRRAKVIIAVSWVLSFCIAGPSLTGWTLVEVPARAPQCVLGYTELPADRAYVVTLVVAVFFAPFGV    141 - 210
MLCAYMCILNTVRKNAVRVHNQSDSLDLRQLTRAGLRRLQRQQQVSVDLSFKTKAFTTILILFVGFSLCW    211 - 280
LPHSVYSLLSVFSQRFYCGSSFYATSTCVLWLSYLKSVFNPIVYCWRIKKFREACIELLPQTFQILPKVP    281 - 350
ERIRRRIQPSTVYVCNENQSAV                                                    351 - 372
//

Text Mined References (9)

PMID Year Title