Property Summary

NCBI Gene PubMed Count 7
PubMed Score 17.44
PubTator Score 6.70

Knowledge Summary

Patent (3,681)

TINX Plot

  Disease (3)

Disease Target Count P-value
diabetes mellitus 1728 1.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Ichthyosis vulgaris 11 3.489 1.7

Gene RIF (3)

AA Sequence

MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALADLLLAACLPFL      1 - 70
AAFYLSLQAWHLGRVGCWALHFLLDLSRSVGMAFLAAVALDRYLRVVHPRLKVNLLSPQAALGVSGLVWL     71 - 140
LMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEALSCLQFVLPFGLIVFCNAGIIRALQKRLRE    141 - 210
PEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPV    211 - 280
VYCFSSPTFRSSYRRVFHTLRGKGQAAEPPDFNPRDSYS                                   281 - 319
//

Text Mined References (8)

PMID Year Title