Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.56

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 1.6e-04


  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 1.6e-04


Accession Q9H9Y4 Q96HG4 Q9NUE1 Q9NW30
Symbols ATPBD1B


PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

ADFHFSSTLGIQEKYLAPSNQSVEQEAMQL                                            281 - 310

Text Mined References (9)

PMID Year Title
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
20864038 2010 HSP90 and its R2TP/Prefoldin-like cochaperone are involved in the cytoplasmic assembly of RNA polymerase II.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16533400 2006 NovelFam3000--uncharacterized human protein domains conserved across model organisms.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.