Property Summary

Ligand Count 8
NCBI Gene PubMed Count 210
PubMed Score 706.42
PubTator Score 333.46

Knowledge Summary

Patent (11,601)

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
breast carcinoma -1.500 2.8e-03
ductal carcinoma in situ -1.100 3.9e-03
fibroadenoma -2.000 4.0e-02
gastric carcinoma -2.200 3.0e-02
lung adenocarcinoma -2.400 4.0e-10
malignant mesothelioma -1.200 3.1e-06
medulloblastoma, large-cell -1.100 1.6e-03
non-small cell lung cancer -1.236 3.9e-14
pancreatic ductal adenocarcinoma liver m... -1.053 1.4e-02

Synonym

Accession Q99527 A8K6C5 B5BUJ1 O00143 O43494 Q13631 Q6FHL1 Q96F42 Q99981
Symbols mER
CEPR
GPER
DRY12
FEG-1
GPR30
LERGU
LyGPR
CMKRL2
LERGU2
GPCR-Br

Gene

PANTHER Protein Class (2)

Gene RIF (167)

AA Sequence

MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLF      1 - 70
PIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVN     71 - 140
MYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFAD    141 - 210
VREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFIS    211 - 280
VHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNR    281 - 350
FCHAALKAVIPDSTEQSDVRFSSAV                                                 351 - 375
//

Text Mined References (219)

PMID Year Title