Property Summary

NCBI Gene PubMed Count 14
PubMed Score 31.96
PubTator Score 32.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Breast cancer -2.000 4.6e-08
cystic fibrosis 1.500 3.6e-04
group 3 medulloblastoma -1.200 4.1e-03
intraductal papillary-mucinous adenoma (... 1.700 2.7e-02
intraductal papillary-mucinous neoplasm ... 2.200 3.9e-02
invasive ductal carcinoma -2.200 8.9e-03
medulloblastoma, large-cell -1.200 4.9e-04
non-small cell lung cancer -1.049 4.1e-06
osteosarcoma -2.859 6.0e-04
ovarian cancer -1.500 3.0e-04
pituitary cancer 1.100 2.0e-03
spina bifida -1.902 4.8e-02
tuberculosis -1.200 1.8e-02

Gene RIF (4)

AA Sequence

MEGAELAGKILSTWLTLVLGFILLPSVFGVSLGISEIYMKILVKTLEWATIRIEKGTPKESILKNSASVG      1 - 70
IIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQYISLR     71 - 140
LTMVWVLGVIVRYCVLLPLRVTLAFIGISLLVIGTTLVGQLPDSSLKNWLSELVHLTCCRICVRALSGTI    141 - 210
HYHNKQYRPQKGGICVANHTSPIDVLILTTDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRH    211 - 280
LVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMV    281 - 350
SYLLRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQ    351 - 420
KNYSKMIVGNGSLS                                                            421 - 434
//

Text Mined References (19)

PMID Year Title