Property Summary

NCBI Gene PubMed Count 20
PubMed Score 75.90
PubTator Score 100.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.200 2.4e-04
non-small cell lung cancer -1.664 2.0e-18
intraductal papillary-mucinous carcinoma... 1.900 8.1e-03
colon cancer -1.500 4.9e-02
lung adenocarcinoma -1.900 7.1e-13
lung carcinoma -1.200 1.2e-06

Gene RIF (12)

PMID Text
23898208 HIV-1 Tat downregulates the expression of glycoprotein A33 (GPA33) in human primary T cells
23294608 Data indicate positive staining was observed for both A33 expression and KRN330 binding from patients biopsied on Day 8, 9 or 14 following initial dosing of 3 mg/kg.
23230278 Data indicate that EpCAM- and A33-Exos were released from the apical and basolateral surfaces, respectively.
22623782 Increased interaction between vaccinia virus proteins A33 and B5 is detrimental to infectious extracellular enveloped virion production.
22623777 The A33-dependent incorporation of B5 into extracellular enveloped vaccinia virions is mediated through an interaction between their lumenal domains.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of glycoprotein A33, transmembrane (GPA33) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19064610 Observational study of gene-disease association. (HuGE Navigator)
18236042 This work has demonstrated that the antigen is both highly immobile and extremely persistent-retaining its surface localization for a turnover halflife of greater than 2 days.
12853980 Regulation of A33 antigen expression by GKLF.
12114523 cloning, chromosomal localizations, exon-intron structures and transcription start sites - target gene for the intestine-specific homeobox transcription factor, CDX1.

AA Sequence

MVGKMWPVLWTLCAVRVTVDAISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVV      1 - 70
IWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVP     71 - 140
PSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYI    141 - 210
CTSSNEEGTQFCNITVAVRSPSMNVALYVGIAVGVVAALIIIGIIIYCCCCRGKDDNTEDKEDARPNREA    211 - 280
YEEPPEQLRELSREREEEDDYRQEEQRSTGRESPDHLDQ                                   281 - 319
//

Text Mined References (22)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23294608 2013 Safety, pharmacokinetics and pharmacodynamics of the anti-A33 fully-human monoclonal antibody, KRN330, in patients with advanced colorectal cancer.
23230278 2013 Two distinct populations of exosomes are released from LIM1863 colon carcinoma cell-derived organoids.
22623782 2012 Increased interaction between vaccinia virus proteins A33 and B5 is detrimental to infectious extracellular enveloped virion production.
22623777 2012 The A33-dependent incorporation of B5 into extracellular enveloped vaccinia virions is mediated through an interaction between their lumenal domains.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
18236042 2008 A33 antigen displays persistent surface expression.
17227111 2007 Human leukocyte antigen alleles and haplotypes associated with chronicity of hepatitis B virus infection in Koreans.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853980 2003 Transcriptional regulation of A33 antigen expression by gut-enriched Krüppel-like factor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12114523 2002 Analysis of the regulation of the A33 antigen gene reveals intestine-specific mechanisms of gene expression.
11487543 2001 Intestinal epithelial cells secrete exosome-like vesicles.
9542130 1998 Micro-sequencing strategies for the human A33 antigen, a novel surface glycoprotein of human gastrointestinal epithelium.
9245713 1997 Characterization of posttranslational modifications of human A33 antigen, a novel palmitoylated surface glycoprotein of human gastrointestinal epithelium.
9012807 1997 The human A33 antigen is a transmembrane glycoprotein and a novel member of the immunoglobulin superfamily.