Property Summary

NCBI Gene PubMed Count 17
PubMed Score 26.03
PubTator Score 27.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Rheumatoid Arthritis 1.500 2.3e-02
esophageal adenocarcinoma 1.100 4.0e-02
psoriasis -1.900 1.7e-03
astrocytoma 1.900 3.1e-03
oligodendroglioma 1.100 4.4e-13
ependymoma 1.200 3.1e-04
glioblastoma 1.500 2.6e-02
medulloblastoma, large-cell 1.300 1.7e-03
hereditary spastic paraplegia -1.147 1.6e-02
primary pancreatic ductal adenocarcinoma 1.451 3.0e-03
intraductal papillary-mucinous carcinoma... 1.400 2.4e-03
lung cancer 1.700 1.6e-05
adult high grade glioma 1.800 2.1e-03
group 4 medulloblastoma -1.600 6.8e-04
pilocytic astrocytoma 1.300 2.2e-03
subependymal giant cell astrocytoma 2.307 2.7e-02
Pick disease 1.700 1.1e-02
ovarian cancer 2.200 1.8e-06
Gaucher disease type 3 1.300 2.1e-02

 GO Process (1)

Gene RIF (6)

PMID Text
26446839 Findings suggest the unexpected presence of quality control in the Golgi that recognizes aggregated Golgi proteins, GPP130, and targets them for degradation in lysosomes.
23761068 Characteristics of GPP130 and its STx/STx1 binding interface.
20130081 the stem domain of GPP130 is a novel Mn sensor in the Golgi lumen of mammalian cells
17605763 Multiple pH-regulated steps affect the trafficking of GPP130.
15331763 GPP130 mediates exit from endosomes and thereby underlies Shiga toxin invasion and retrieval-based targeting of other cycling Golgi proteines
12207053 both the translation and transcription are regulated independent of the cell cycle and dissociated from the duplication of the centrosome

AA Sequence

MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYYELQTQLRKAEAVALKYQQHQESLSAQLQVVYEHRSR      1 - 70
LEKSLQKERLEHKKAKEDFLVYKLEAQETLNKGRQDSNSRYSALNVQHQMLKSQHEELKKQHSDLEEEHR     71 - 140
KQGEDFSRTFNDHKQKYLQLQQEKEQELSKLKETVYNLREENRQLRKAHQDIHTQLQDVKQQHKNLLSEH    141 - 210
EQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQ    211 - 280
EVSRNNDVWQNHEAVPGRAEDTKLYAPTHKEAEFQAPPEPIQQEVERREPEEHQVEEEHRKALEEEEMEQ    281 - 350
VGQAEHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQ    351 - 420
VEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDI    421 - 490
VQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGED    491 - 560
EFEEAEQVREENLPDENEEQKQSNQKQENTEVEEHLVMAGNPDQQEDNVDEQYQEEAEEEVQEDLTEEKK    561 - 630
RELEHNAEETYGENDENTDDKNNDGEEQEVRDDNRPKGREEHYEEEEEEEEDGAAVAEKSHRRAEM        631 - 696
//

Text Mined References (22)

PMID Year Title
26446839 2015 Induced oligomerization targets Golgi proteins for degradation in lysosomes.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25087078 2014 Genetic determinants of common epilepsies: a meta-analysis of genome-wide association studies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23761068 2013 Shiga toxin-binding site for host cell receptor GPP130 reveals unexpected divergence in toxin-trafficking mechanisms.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
21269460 2011 Initial characterization of the human central proteome.
20130081 2010 Manganese-induced trafficking and turnover of the cis-Golgi glycoprotein GPP130.
19946888 2010 Defining the membrane proteome of NK cells.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17605763 2007 Both post-Golgi and intra-Golgi cycling affect the distribution of the Golgi phosphoprotein GPP130.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15331763 2004 A cycling cis-Golgi protein mediates endosome-to-Golgi traffic.
15004235 2004 The COG and COPI complexes interact to control the abundance of GEARs, a subset of Golgi integral membrane proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12207053 2002 Expression of Golgi membrane protein p138 is cell cycle-independent and dissociated from centrosome duplication.
12191016 2002 Cycling of early Golgi proteins via the cell surface and endosomes upon lumenal pH disruption.
11598199 2001 Lumenal endosomal and Golgi-retrieval determinants involved in pH-sensitive targeting of an early Golgi protein.
9201717 1997 Sequence and overexpression of GPP130/GIMPc: evidence for saturable pH-sensitive targeting of a type II early Golgi membrane protein.