Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NMD2 H3BRU0
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
OMA EggNOG

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MAEETQHNKLAAAKKKLKEYWQKNSPRVPAGANRNRKTNGSIPEKATSGGCQPPRDSATGFHREGPTSSA      1 - 70
TLKDLESPCQERAVVLDSRSVEISQLKNTIKSLKQQKKQVEHQLEEEKKANNKKQKAKRVLEVQIQTLNI     71 - 140
QKEELNTDLYHMKRSLRYFEEKSKDLAVRLQHSLQRKGELESVLSNVMATQKKKANQLSSRSKARTEWKL    141 - 210
EQSMREEALLKVQLTQFKESFQQVQLERDEYSEHLKGERARWQQRMRKMSQEICTLKKEKQQDMRRVEKL    211 - 280
ERSLSKLKNQMAEPLPPEPPAVPSEVELQHLRKELERVAGELQAQVKNNQRISLLNQRQEERIREQEERL    281 - 350
RKQEERIQEQHKSLQQLAKPQSVFKEPNNENKNALQLEQQVKELQEKLGEEHLEAASQQNQQLTAQLSLM    351 - 420
ALPGEGHGGEHLDSEGEEAPRPMPSVPEDPESREAMSSFMDHLEEKADLSELVKKKELCFIHHWRERCHQ    421 - 490
KTHHLLSEPGGRAKDAALGGGHHQAGAQGGDEGEAAGAAADGIAAYSNYNNGHRKFLAAAHNSADEPGPG    491 - 560
APAPQELGAADKHGHLCEVSLTSSAQGEAREDPLLDKPTAQPIVQDHQEHPGLGSNCCVPFLCWAWLPRR    561 - 630
RR                                                                        631 - 632
//

Text Mined References (2)

PMID Year Title