Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.28
PubTator Score 5.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Breast cancer -1.300 3.3e-03
breast carcinoma -1.500 3.2e-25
ductal carcinoma in situ -1.900 2.2e-04
ependymoma 1.500 9.3e-06
gastric cancer 1.700 2.8e-03
glioblastoma 1.200 5.4e-03
hepatocellular carcinoma 1.200 8.3e-03
interstitial cystitis 1.200 3.1e-03
intraductal papillary-mucinous adenoma (... -3.000 5.4e-07
intraductal papillary-mucinous carcinoma... -3.300 4.3e-07
intraductal papillary-mucinous neoplasm ... -3.200 6.1e-05
invasive ductal carcinoma -2.600 7.2e-05
juvenile dermatomyositis 1.329 1.7e-08
lung adenocarcinoma -2.100 2.6e-16
lung cancer -2.100 1.9e-04
lung carcinoma -1.900 1.8e-10
malignant mesothelioma -4.500 4.6e-09
medulloblastoma, large-cell -1.700 7.3e-03
non-small cell lung cancer -2.518 1.8e-19
ovarian cancer -5.000 6.4e-16
pancreatic cancer 2.100 8.6e-04
pancreatic carcinoma 2.100 8.6e-04
psoriasis -1.200 1.1e-04
ulcerative colitis 2.000 2.0e-04

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSC      1 - 70
VIS                                                                        71 - 73
//

Text Mined References (15)

PMID Year Title