Property Summary

NCBI Gene PubMed Count 124
PubMed Score 16.58
PubTator Score 25.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Rheumatoid Arthritis -1.500 1.6e-02
glioblastoma 1.600 3.9e-07
posterior fossa group A ependymoma 1.100 8.3e-05
ulcerative colitis 1.200 7.9e-05

Protein-protein Interaction (163)

Gene RIF (37)

PMID Text
26662512 Kinocilium is essential for proper localization of Lgn, as well as Gai and aPKC, suggesting that cilium function plays a role in positioning of apical proteins critical for hearing.
25788576 Galpha(i2) activates the TRPC4 channel by direct binding.
25078664 We observed increased expression of Galphai1/3 in wounded human skin and keloid skin tissues, suggesting the possible involvement of Galphai1/3 in wound healing and keloid formation.
24423449 Data strongly implicate GNAI2 as a critical regulator of oncogenesis and an upstream driver of cancer progression in ovarian carcinoma.
24415754 HIV-1 gp120-mediated phosphorylation of WAVE2 requires both G(alpha)i-dependent and -independent pathways, and is conserved both in X4 and R5 viral infection of resting CD4 T cells and primary macrophages
24298018 Galphai2(Q205L) regulates satellite cell differentiation into myotubes in a protein kinase C - and histone deacetylase -dependent manner
24011658 Changes in ion selectivity and pore dilation of the TRPC4 channel elicited by the Galphai2 subunit, were studied.
23665327 The ubiquitination of Galphai2 and Galphaq is suppressed by expression of Ric-8A. The suppression likely requires Ric-8A interaction with these Galpha proteins; the C-terminal truncation of Galphaq and Galphai2 completely abrogates their interaction with Ric-8A.
23490066 There is an interaction between the activated Gsalpha subunit and membrane lipid microdomains in the pathophysiology of some major depressive disorders.
23430985 These results suggest that the extent of G-protein-mediated inhibition is significantly reduced in the K1336E mutant CaV2.1 Ca(2+) channels
23071112 HIV-1 Nef impairs heterotrimeric G-protein signaling by targeting Galpha(i2) for degradation through ubiquitination
23071112 HIV-1 gp120-mediated phosphorylation of WAVE2 requires both G(alpha)i-dependent and -independent pathways, and is conserved both in X4 and R5 viral infection of resting CD4 T cells and primary macrophages
22936789 Gialpha2 plays an essential role in OXT and EGF signaling to induce prostate cancer cell migration.
22333621 Galphai2 as a novel claudin-5 partner required for TJ integrity in brain endothelial cells.
21949112 Suggest that Gnia2 is involved in endothelial TLR pathways along a signaling cascade that is distinct from MyD88.
21856938 SDF-1 treatment of T cells induced the formation of a novel molecular signaling complex containing RasGRP1, Galphai2, and ZAP-70.
21079996 Study identified a number of high-confident miR-138 target genes, including proto-oncogene GNAI2, which may play an important role in tongue squamous cell carcinoma. initiation and progression.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19542234 Data support the notion that oligomerization of the mu-opioid receptor is not required for agonist and antagonist binding in regard to allosteric regulation of agonist binding by Gi2.
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19282110 This suggests a novel set of candidate genes for NS (GNAI2 and RGS proteins) and if validated could have important implications for therapy as well.
19169048 Observational study of gene-disease association. (HuGE Navigator)
18940181 These results show that G(i2) protein is involved in D(2)R-mediated ERK activation but beta-arrestins 1 and 2 are either not involved or play minor role.
18854172 These results suggest that Galphai2 is involved specifically in the activation of TRPC4.
18453587 HIV-1 gp120-mediated phosphorylation of WAVE2 requires both G(alpha)i-dependent and -independent pathways, and is conserved both in X4 and R5 viral infection of resting CD4 T cells and primary macrophages
16565233 Observational study of gene-disease association. (HuGE Navigator)
16565233 a GNAI2 -318 C>G SNP impairs transcriptional activity through specific binding of Sp1 and is associated with high SBP in Caucasians from Italy
15972662 HIV-1 gp120-mediated phosphorylation of WAVE2 requires both G(alpha)i-dependent and -independent pathways, and is conserved both in X4 and R5 viral infection of resting CD4 T cells and primary macrophages
15640523 the Galphai2 gene promoter is transcriptionally activated through nuclear factor-kappaB and antioxidant response elements
15331550 in elderly subjects of similar ages, those with diabetes have 1.7-fold higher levels of Galpha(i2) and twofold higher levels of Gbeta(1).
15126921 Abnormal regulation of GNAI2 was studied in cultured skin fibroblasts from insulin-resistant hypertensive individuals.
14701866 Galphai2 has a role in calcium-sensing receptor-mediated ERK1/2 activation
14623802 Cholesterol lowering by pravastatin might increase the response of the heart to parasympathetic stimulation and changes in Galpha(i2) expression might serve as a molecular marker for this effect
12624107 valproic acid-induced expression of Galphai2 is regulated by Sp1 transcription factor
12359238 Modulation of G(ialpha(2)) signaling by the axonal guidance molecule UNC5H2
12088413 CXCL12 upregulated T-cell activation, and an alpha(i) G-coupled protein mediated signaling pathway was necessary for stimulation of T cells by CXCL12.

AA Sequence

MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYR      1 - 70
AVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQAC     71 - 140
FGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERK    141 - 210
KWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIT    211 - 280
HSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLK    281 - 350
DCGLF                                                                     351 - 355
//

Text Mined References (132)

PMID Year Title
26662512 2016 The GPSM2/LGN GoLoco motifs are essential for hearing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25788576 2015 Close spatio-association of the transient receptor potential canonical 4 (TRPC4) channel with G?i in TRPC4 activation process.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25078664 2015 Requirement of G?i1/3-Gab1 signaling complex for keratinocyte growth factor-induced PI3K-AKT-mTORC1 activation.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24423449 2014 Suppression of GNAI2 message in ovarian cancer.
24298018 2014 G?i2 signaling is required for skeletal muscle growth, regeneration, and satellite cell proliferation and differentiation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24141704 2013 A bacterial toxin catalyzing tyrosine glycosylation of Rho and deamidation of Gq and Gi proteins.
24011658 2013 Activation of TRPC4? by G?i subunit increases Ca2+ selectivity and controls neurite morphogenesis in cultured hippocampal neuron.
23773523 2013 Differential G protein subunit expression by prostate cancer cells and their interaction with CXCR5.
23665327 2013 Ubiquitination of the heterotrimeric G protein ? subunits G?i2 and G?q is prevented by the guanine nucleotide exchange factor Ric-8A.
23490066 2013 Increased Gs? within blood cell membrane lipid microdomains in some depressive disorders: an exploratory study.
23430985 2013 The familial hemiplegic migraine type 1 mutation K1336E affects direct G protein-mediated regulation of neuronal P/Q-type Ca2+ channels.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23071112 2012 HIV-1 Nef impairs heterotrimeric G-protein signaling by targeting G?(i2) for degradation through ubiquitination.
22936789 2012 The essential role of Gi?2 in prostate cancer cell migration.
22333621 2012 Guanine nucleotide-binding protein G?i2: a new partner of claudin-5 that regulates tight junction integrity in human brain endothelial cells.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21949112 2011 Heterotrimeric Gi/Go proteins modulate endothelial TLR signaling independent of the MyD88-dependent pathway.
21856938 2011 G alpha i2 and ZAP-70 mediate RasGRP1 membrane localization and activation of SDF-1-induced T cell functions.
21269460 2011 Initial characterization of the human central proteome.
21079996 2011 Identification and experimental validation of G protein alpha inhibiting activity polypeptide 2 (GNAI2) as a microRNA-138 target in tongue squamous cell carcinoma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19542234 2009 Purification and functional reconstitution of monomeric mu-opioid receptors: allosteric modulation of agonist binding by Gi2.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19282110 2009 GNAI2 and regulators of G protein signaling as a potential Noonan syndrome mechanism.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19169048 2008 Non-functioning pituitary adenomas infrequently harbor G-protein gene mutations.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18940181 2008 Roles of G protein and beta-arrestin in dopamine D2 receptor-mediated ERK activation.
18854172 2008 The specific activation of TRPC4 by Gi protein subtype.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17635935 2007 Localization of Gi alpha proteins in the centrosomes and at the midbody: implication for their role in cell division.
17550964 2007 Role of a Galphai2 protein splice variant in the formation of an intracellular dopamine D2 receptor pool.
16892066 2006 Mechanism of the receptor-catalyzed activation of heterotrimeric G proteins.
16782902 2006 Activation state-dependent interaction between Galphai and p67phox.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16565233 2006 The -318 C>G single-nucleotide polymorphism in GNAI2 gene promoter region impairs transcriptional activity through specific binding of Sp1 transcription factor and is associated with high blood pressure in Caucasians from Italy.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16298104 2006 G-protein alpha subunit interaction and guanine nucleotide dissociation inhibitor activity of the dual GoLoco motif protein PCP-2 (Purkinje cell protein-2).
16263121 2005 A proteomic snapshot of the human heat shock protein 90 interactome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15640523 2005 Transcriptional activation of the human Galphai2 gene promoter through nuclear factor-kappaB and antioxidant response elements.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15331550 2004 Increased expression of Gi-coupled muscarinic acetylcholine receptor and Gi in atrium of elderly diabetic subjects.
15312896 2004 Distribution of C-terminal splice variant of G alpha i2 in rat and monkey brain.
15251452 2004 CCL3, acting via the chemokine receptor CCR5, leads to independent activation of Janus kinase 2 (JAK2) and Gi proteins.
15126921 2004 Abnormal regulation of G protein alpha(i2) subunit in skin fibroblasts from insulin-resistant hypertensive individuals.
14993377 2002 Isoforms of mammalian adenylyl cyclase: multiplicities of signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701866 2004 Calcium-sensing receptor-mediated ERK1/2 activation requires Galphai2 coupling and dynamin-independent receptor internalization.
14634662 2003 RGS16 inhibits signalling through the G alpha 13-Rho axis.
14623802 2003 Lipid lowering by pravastatin increases parasympathetic modulation of heart rate: Galpha(i2), a possible molecular marker for parasympathetic responsiveness.
12860983 2003 Oxidized human neuroglobin acts as a heterotrimeric Galpha protein guanine nucleotide dissociation inhibitor.
12748287 2003 Identification of tetratricopeptide repeat 1 as an adaptor protein that interacts with heterotrimeric G proteins and the small GTPase Ras.
12624107 2003 Sp family of transcription factors is involved in valproic acid-induced expression of Galphai2.
12519789 2003 Proteomic and biochemical analyses of human B cell-derived exosomes. Potential implications for their function and multivesicular body formation.
12509430 2003 Mammalian Ric-8A (synembryn) is a heterotrimeric Galpha protein guanine nucleotide exchange factor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359238 2002 Modulation of G(ialpha(2)) signaling by the axonal guidance molecule UNC5H2.
12088413 2001 Stimulation of T-Cell activation by CXCL12/stromal cell derived factor-1 involves a G-protein mediated signaling pathway.
12068084 2002 Agonists activate Gi1 alpha or Gi2 alpha fused to the human mu opioid receptor differently.
11955952 2002 Cloning and characterization of a novel regulator of G protein signalling in human platelets.
11950062 2002 Impaired interactions between mouse Eyal harboring mutations found in patients with branchio-oto-renal syndrome and Six, Dach, and G proteins.
11387333 2001 RGS12 and RGS14 GoLoco motifs are G alpha(i) interaction sites with guanine nucleotide dissociation inhibitor Activity.
11369591 2001 Stimulation by n6-cyclopentyladenosine of A1 adenosine receptors, coupled to galphai2 protein subunit, has a capacitative effect on human spermatozoa.
11286993 2001 Specific involvement of G(alphai2) with epidermal growth factor receptor signaling in rat hepatocytes, and the inhibitory effect of chronic ethanol.
11196645 2001 Identification of the platelet ADP receptor targeted by antithrombotic drugs.
11168387 2001 CB1 receptor-G protein association. Subtype selectivity is determined by distinct intracellular domains.
11120746 2001 Coupling of the insulin-like growth factor-I receptor tyrosine kinase to Gi2 in human intestinal smooth muscle: Gbetagamma -dependent mitogen-activated protein kinase activation and growth.
11118617 2000 Cloning and characterization of the human phosphoinositide-specific phospholipase C-beta 1 (PLC beta 1).
11055978 2000 Functional reconstitution of the angiotensin II type 2 receptor and G(i) activation.
10978845 2000 Coupling of dopamine receptor subtypes to multiple and diverse G proteins.
10906137 2000 The alpha subunits of Gz and Gi interact with the eyes absent transcription cofactor Eya2, preventing its interaction with the six class of homeodomain-containing proteins.
10840027 2000 Activation of heterotrimeric G-protein signaling by a ras-related protein. Implications for signal integration.
10727522 2000 Molecular cloning and characterization of a lysophosphatidic acid receptor, Edg-7, expressed in prostate.
10644723 2000 PAR1 thrombin receptor-G protein interactions. Separation of binding and coupling determinants in the galpha subunit.
10598579 1999 Dual signaling of human Mel1a melatonin receptors via G(i2), G(i3), and G(q/11) proteins.
10493819 1999 The luteinizing hormone receptor activates phospholipase C via preferential coupling to Gi2.
10471929 1999 Genetic screens in yeast to identify mammalian nonreceptor modulators of G-protein signaling.
9660808 1998 Expression of GTPase-deficient Gialpha2 results in translocation of cytoplasmic RGS4 to the plasma membrane.
9647645 1998 The mammalian calcium-binding protein, nucleobindin (CALNUC), is a Golgi resident protein.
9637720 1998 Right ventricular outflow tract tachycardia due to a somatic cell mutation in G protein subunitalphai2.
9237368 1996 Identification and subcellular distribution of the Gi-proteins in the enterocytic-differentiated adenocarcinoma cell-line, Caco-2.
9092559 1997 Insulin-induced activation of NADPH-dependent H2O2 generation in human adipocyte plasma membranes is mediated by Galphai2.
9079700 1997 Characterization of a novel mammalian RGS protein that binds to Galpha proteins and inhibits pheromone signaling in yeast.
8986788 1996 GAIP is membrane-anchored by palmitoylation and interacts with the activated (GTP-bound) form of G alpha i subunits.
8982657 1996 Direct evidence for two distinct G proteins coupling with thrombin receptors in human neuroblastoma SH-EP cells.
8973305 1996 Identification and cDNA cloning of a novel human mosaic protein, LGN, based on interaction with G alpha i2.
8903513 1996 Identification of G-protein binding sites of the human interleukin-8 receptors by functional mapping of the intracellular loops.
8663226 1996 Involvement of Gs and Gi proteins in dual coupling of the luteinizing hormone receptor to adenylyl cyclase and phospholipase C.
8663057 1996 Direct or C5a-induced activation of heterotrimeric Gi2 proteins in human neutrophils is associated with interaction between formyl peptide receptors and the cytoskeleton.
8663053 1996 The AT2 receptor selectively associates with Gialpha2 and Gialpha3 in the rat fetus.
8662698 1996 Physical association of Gi2alpha with interleukin-8 receptors.
8621645 1996 Co-purification and direct interaction of Ras with caveolin, an integral membrane protein of caveolae microdomains. Detergent-free purification of caveolae microdomains.
8587610 1996 Insulin action impaired by deficiency of the G-protein subunit G ialpha2.
8554519 1995 The human platelet ADP receptor activates Gi2 proteins.
8552586 1996 The human thyrotropin receptor: a heptahelical receptor capable of stimulating members of all four G protein families.
8521505 1995 The structure of the G protein heterotrimer Gi alpha 1 beta 1 gamma 2.
8473899 1993 Elevated stimulatory and reduced inhibitory G protein alpha subunits in cerebellar cortex of patients with dominantly inherited olivopontocerebellar atrophy.
8362897 1993 Analysis of the expression of seven G protein alpha subunit genes in hematopoietic cells.
8208289 1994 Structural determinants for activation of the alpha-subunit of a heterotrimeric G protein.
8190105 1994 Transfected muscarinic acetylcholine receptors selectively couple to Gi-type G proteins and Gq/11.
8098045 1993 Characterization and distribution of alpha 2-adrenergic receptors in the human intestinal mucosa.
7962171 1994 Stabilization of C5a receptor--G-protein interactions through ligand binding.
7961880 1994 Regulation of cAMP-mediated gene transcription by wild type and mutated G-protein alpha subunits. Inhibition of adenylyl cyclase activity by muscarinic receptor-activated and constitutively activated G(o) alpha.
7937899 1994 Mechanism of GTP hydrolysis by G-protein alpha subunits.
7887906 1995 Analysis of the relative interactions between the alpha 2C10 adrenoceptor and the guanine-nucleotide-binding proteins G(o)1 alpha and Gi 2 alpha following co-expression of these polypeptides in rat 1 fibroblasts.
7882989 1995 Molecular identification of guanine-nucleotide-binding regulatory proteins which couple to endothelin receptors.
7737262 1995 G-protein mutations in human pituitary adrenocorticotrophic hormone-secreting adenomas.
3120178 1987 A small multigene family encodes Gi signal-transduction proteins.
3100330 1987 Human Gi protein alpha-subunit: deduction of amino acid structure from a cloned cDNA.
2837412 1988 Cloning and characterization of the human gene for the alpha-subunit of Gi2, a GTP-binding signal transduction protein.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.
2512386 1989 Distribution of the alpha-subunit of the guanine nucleotide-binding protein Gi2 and its comparison to G alpha o.
2502457 1989 G-protein alpha-subunits in cytosolic and membranous fractions of human neutrophils.
2169434 1990 The alpha 2B adrenergic receptor of undifferentiated neuroblastoma x glioma hybrid NG108-15 cells, interacts directly with the guanine nucleotide binding protein, Gi2.
2121366 1990 G alpha i-G alpha s chimeras define the function of alpha chain domains in control of G protein activation and beta gamma subunit complex interactions.
2116665 1990 Two G protein oncogenes in human endocrine tumors.
2114093 1990 Hormonal regulation of Gi2 alpha-subunit phosphorylation in intact hepatocytes.
1733849 1992 Regional localization of the human G protein alpha i2 (GNAI2) gene: assignment to 3p21 and a related sequence (GNAI2L) to 12p12-p13.
1718802 1991 Identification of G protein alpha-subunits in RINm5F cells and their selective interaction with galanin receptor.
1671672 1991 Evidence for opioid receptor-mediated activation of the G-proteins, Go and Gi2, in membranes of neuroblastoma x glioma (NG108-15) hybrid cells.