Property Summary

NCBI Gene PubMed Count 103
PubMed Score 11.80
PubTator Score 97.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute quadriplegic myopathy 1.297 1.3e-06
Alzheimer's disease 1.100 2.7e-02
astrocytic glioma 2.100 1.4e-02
atypical teratoid / rhabdoid tumor 1.900 6.2e-04
breast carcinoma 1.100 5.7e-03
ependymoma 2.400 3.4e-02
gastric cancer -2.000 3.2e-02
Gaucher disease type 3 -1.100 1.7e-02
glioblastoma 2.000 1.2e-03
group 4 medulloblastoma 2.200 4.0e-04
invasive ductal carcinoma 1.200 1.5e-02
juvenile dermatomyositis 1.085 1.1e-10
medulloblastoma, large-cell 2.800 2.9e-05
oligodendroglioma 2.000 3.4e-02
osteosarcoma 2.589 2.5e-03
ovarian cancer -1.300 9.5e-04
pediatric high grade glioma 1.100 2.4e-02
Pick disease 1.500 6.9e-05
primary Sjogren syndrome 1.600 7.5e-03
psoriasis -1.200 1.2e-11
sarcoidosis 1.100 1.6e-02
ulcerative colitis -1.400 4.7e-03

Gene RIF (57)

AA Sequence

MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRI      1 - 70
IHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETR     71 - 140
VFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYD    141 - 210
FEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRV    211 - 280
FSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAI    281 - 350
NTENIRLVFRDVKDTILHDNLKQLMLQ                                               351 - 377
//

Text Mined References (110)

PMID Year Title