Property Summary

NCBI Gene PubMed Count 15
PubMed Score 169.65
PubTator Score 60.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 6.8e-03
psoriasis 2.700 1.5e-04
osteosarcoma 2.415 5.6e-04
atypical teratoid / rhabdoid tumor 1.700 1.1e-06
glioblastoma 1.800 1.5e-06
medulloblastoma 1.400 1.2e-05
medulloblastoma, large-cell 1.700 1.1e-03
primitive neuroectodermal tumor 1.100 1.1e-04
acute quadriplegic myopathy 1.158 6.7e-07
Atopic dermatitis 1.100 2.3e-04
tuberculosis and treatment for 3 months -1.300 1.9e-05
intraductal papillary-mucinous neoplasm ... 1.500 4.2e-02
lung cancer 1.400 1.0e-02
diabetes mellitus -1.100 7.8e-03
pediatric high grade glioma 1.200 2.4e-03
pilocytic astrocytoma 1.200 7.4e-04
aldosterone-producing adenoma -1.140 2.4e-02
breast carcinoma 1.200 8.5e-19
progressive supranuclear palsy -1.100 3.2e-02
ductal carcinoma in situ 1.200 6.9e-04
invasive ductal carcinoma 1.900 2.0e-04
ovarian cancer -2.200 1.9e-08
Down syndrome 1.500 1.0e-03

Synonym

Accession P60983 B2R499 P17774 Q9BS35 GMF-beta
Symbols GMF

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
22035352 The distribution of GMF-immunoreactive cells in and around amyloid plaques and neurofibrillary tangles suggests involvement of GMF in inflammatory responses through reactive glia and a role of GMF in Alzheimer disease pathology.
21835226 GMF co-localizes with amyloid plaques and neurofibrillary tangles in Alzheimer brains, implicating significant upregulation of GMF expression under conditions of neurodegeneration.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18171522 There is a significant increase in GMF beta protein expression levels in IFN beta-1a treated LX-2 cells.
16115230 GMFB promoted T-cell differentiation into CD4-/CD8+ cells when analysed by two-colour flow cytometry.

AA Sequence

MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIV      1 - 70
YSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGF     71 - 140
FH                                                                        141 - 142
//

Text Mined References (22)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22035352 2012 Expression of glia maturation factor in neuropathological lesions of Alzheimer's disease.
21835226 2011 Augmented expression of glia maturation factor in Alzheimer's disease.
21269460 2011 Initial characterization of the human central proteome.
20547056 2010 Identification of glia maturation factor beta as an independent prognostic predictor for serous ovarian cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18171522 2007 [Effect of glia maturation factor beta on the activation of hepatic stellate cells and on liver fibrosis].
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16115230 2005 Glia maturation factor-beta is produced by thymoma and may promote intratumoral T-cell differentiation.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9545571 1998 Isolation of novel human cDNA (hGMF-gamma) homologous to Glia Maturation Factor-beta gene.
8798479 1996 In vitro enhancement of p38 mitogen-activated protein kinase activity by phosphorylated glia maturation factor.
8639570 1996 In vitro inhibition of MAP kinase (ERK1/ERK2) activity by phosphorylated glia maturation factor (GMF).
7598724 1995 Phorbol ester stimulates rapid intracellular phosphorylation of glia maturation factor.
1712830 1991 Molecular cloning and expression of biologically active human glia maturation factor-beta.