Property Summary

NCBI Gene PubMed Count 45
PubMed Score 27.06
PubTator Score 36.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer -1.200 1.4e-11
breast carcinoma -1.100 4.3e-44
group 3 medulloblastoma 1.100 1.1e-02
intraductal papillary-mucinous carcinoma... -1.300 1.2e-02
intraductal papillary-mucinous neoplasm ... -2.000 7.1e-04
invasive ductal carcinoma -1.100 1.1e-02
lung adenocarcinoma -1.100 5.5e-08
lung cancer -4.700 6.8e-03
medulloblastoma, large-cell 1.200 6.4e-05
osteosarcoma -1.809 2.5e-05
ovarian cancer -1.500 1.4e-04
pancreatic ductal adenocarcinoma liver m... 1.809 6.6e-04
psoriasis -1.100 3.2e-39
Waldenstrons macroglobulinemia 1.054 3.1e-02

Gene RIF (27)

AA Sequence

MAAGGSGVGGKRSSKSDADSGFLGLRPTSVDPALRRRRRGPRNKKRGWRRLAQEPLGLEVDQFLEDVRLQ      1 - 70
ERTSGGLLSEAPNEKLFFVDTGSKEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVP     71 - 140
NAKKLRRKEQLWEKLAKQGELPREVRRAQARLLNPSATRAKPGPQDTVERPFYDLWASDNPLDRPLVGQD    141 - 210
EFFLEQTKKKGVKRPARLHTKPSQAPAVEVAPAGASYNPSFEDHQTLLSAAHEVELQRQKEAEKLERQLA    211 - 280
LPATEQAATQESTFQELCEGLLEESDGEGEPGQGEGPEAGDAEVCPTPARLATTEKKTEQQRRREKAVHR    281 - 350
LRVQQAALRAARLRHQELFRLRGIKAQVALRLAELARRQRRRQARREAEADKPRRLGRLKYQAPDIDVQL    351 - 420
SSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL                421 - 478
//

Text Mined References (49)

PMID Year Title