Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.54
PubTator Score 5.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 1.1e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Periodontal disease 40 0.0 3.0
Disease Target Count Z-score Confidence
Aggressive Periodontitis 12 5.28 2.6

Gene RIF (8)

AA Sequence

MNSKRMLLLVLFAFSLMLVERYFRNHQVEELRLSDWFHPRKRPDVITKTDWLAPVLWEGTFDRRVLEKHY      1 - 70
RRRNITVGLAVFATGRFAEEYLRPFLHSANKHFMTGYRVIFYIMVDAFFKLPDIEPSPLRTFKAFKVGTE     71 - 140
RWWLDGPLVHVKSLGEHIASHIQDEVDFLFSMAANQVFQNEFGVETLGPLVAQLHAWWYFRNTKNFPYER    141 - 210
RPTSAACIPFGQGDFYYGNLMVGGTPHNILDFIKEYLNGVIHDIKNGLNSTYEKHLNKYFYLNKPTKLLS    211 - 280
PAYSWDLAFSPPPQIQYVKVAHDSQRKL                                              281 - 308
//

Text Mined References (6)

PMID Year Title