Property Summary

NCBI Gene PubMed Count 24
PubMed Score 23.76
PubTator Score 29.84

Knowledge Summary

Patent (3,733)

TINX Plot

  Disease (2)

Disease Target Count
Short bowel syndrome 16
Disease Target Count P-value
breast carcinoma 1614 1.3e-03
fibroadenoma 557 4.4e-02

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma -1.100 1.3e-03
fibroadenoma -1.400 4.4e-02

Gene RIF (16)

PMID Text
24875097 Report gastrointestinal GLP-2 receptor and limited utility of GLP-2 in the management of inflammatory intestinal disorders.
22951144 GLP-2 receptors are highly expressed in gastrointestinal stromal tumors and Crohn's disease.
21326311 GLP2R encodes a G protein-coupled receptor and involved in proliferative and anti-apoptotic cellular responses.
21167157 docking studies were performed between the N-terminal extracellular domain of GLP-2 receptor and the GLP-2 hormone
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19861958 Observational study of gene-disease association. (HuGE Navigator)
18829546 Sustained direct or indirect modulation of GLP-2R signaling does not modify intestinal tumor cell growth or survival.
16448646 Endogenously expressing GLP-2 receptor encoding mRNA and protein was identified in intestinal cell lines.
16401478 GLP-2-induced stimulation of blood flow is mediated by vasoactive neurotransmitters that are colocalized with GLP-2R in 2 functionally distinct cell types within the gastrointestinal tract
15817468 GLP-2 receptor C terminus has a role in modulating beta-arrestin-2 association but not ligand-induced desensitization, endocytosis, and G-protein-dependent effector activation
15544847 GLP-2 in the gut acts by activating receptors on the subepithelial myofibroblasts, causing the release of growth factors, which in turn stimulate intestinal growth
15471943 glucagon-like peptide-2 receptor is coupled to regulation of apoptosis and ERK1/2 activation through divergent signaling pathways

AA Sequence

MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLE      1 - 70
ETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPSYLPWWSEESSGRAYRHCLAQ     71 - 140
GTWQTIENATDIWQDDSECSENHSFKQNVDRYALLSTLQLMYTVGYSFSLISLFLALTLLLFLRKLHCTR    141 - 210
NYIHMNLFASFILRTLAVLVKDVVFYNSYSKRPDNENGWMSYLSEMSTSCRSVQVLLHYFVGANYLWLLV    211 - 280
EGLYLHTLLEPTVLPERRLWPRYLLLGWAFPVLFVVPWGFARAHLENTGCWTTNGNKKIWWIIRGPMMLC    281 - 350
VTVNFFIFLKILKLLISKLKAHQMCFRDYKYRLAKSTLVLIPLLGVHEILFSFITDDQVEGFAKLIRLFI    351 - 420
QLTLSSFHGFLVALQYGFANGEVKAELRKYWVRFLLARHSGCRACVLGKDFRFLGKCPKKLSEGDGAEKL    421 - 490
RKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTMANTMEEILEESEI           491 - 553
//

Text Mined References (25)

PMID Year Title
24990862 2014 The CNS glucagon-like peptide-2 receptor in the control of energy balance and glucose homeostasis.
24875097 2014 Glugacon-like peptide-2: broad receptor expression, limited therapeutic effect on intestinal inflammation and novel role in liver regeneration.
22951144 2012 GLP-2 receptors in human disease: high expression in gastrointestinal stromal tumors and Crohn's disease.
21326311 2011 Genome-wide association study identifies genetic variants influencing F-cell levels in sickle-cell patients.
21167157 2011 Conformational and molecular interaction studies of glucagon-like peptide-2 with its N-terminal extracellular receptor domain.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19861958 2010 Genetic analysis in a Dutch study sample identifies more ulcerative colitis susceptibility loci and shows their additive role in disease risk.
18829546 2008 Glucagon-like peptide-2 does not modify the growth or survival of murine or human intestinal tumor cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16448646 2006 Naturally occurring glucagon-like peptide-2 (GLP-2) receptors in human intestinal cell lines.
16401478 2006 GLP-2 receptor localizes to enteric neurons and endocrine cells expressing vasoactive peptides and mediates increased blood flow.
15817468 2005 The glucagon-like peptide-2 receptor C terminus modulates beta-arrestin-2 association but is dispensable for ligand-induced desensitization, endocytosis, and G-protein-dependent effector activation.
15670850 2005 Calmodulin interacts with the cytoplasmic tails of the parathyroid hormone 1 receptor and a sub-set of class b G-protein coupled receptors.
15544847 2005 GLP-2 stimulates colonic growth via KGF, released by subepithelial myofibroblasts with GLP-2 receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471943 2005 The HeLa cell glucagon-like peptide-2 receptor is coupled to regulation of apoptosis and ERK1/2 activation through divergent signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11738243 2002 The truncated metabolite GLP-2 (3-33) interacts with the GLP-2 receptor as a partial agonist.
11238747 2001 Glucagon-like peptide 2: a nutrient-responsive gut growth factor.
10982769 2000 Enteroendocrine localization of GLP-2 receptor expression in humans and rodents.
9990065 1999 Prototypic G protein-coupled receptor for the intestinotrophic factor glucagon-like peptide 2.