Property Summary

Ligand Count 82
NCBI Gene PubMed Count 24
PubMed Score 24.51
PubTator Score 29.84

Knowledge Summary

Patent (3,733)

TINX Plot

  Disease (3)

Disease Target Count
Short bowel syndrome 16
Disease Target Count P-value
breast carcinoma 1638 1.3e-03
fibroadenoma 559 4.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma -1.100 1.3e-03
fibroadenoma -1.400 4.4e-02

Gene RIF (16)

AA Sequence

MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLE      1 - 70
ETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPSYLPWWSEESSGRAYRHCLAQ     71 - 140
GTWQTIENATDIWQDDSECSENHSFKQNVDRYALLSTLQLMYTVGYSFSLISLFLALTLLLFLRKLHCTR    141 - 210
NYIHMNLFASFILRTLAVLVKDVVFYNSYSKRPDNENGWMSYLSEMSTSCRSVQVLLHYFVGANYLWLLV    211 - 280
EGLYLHTLLEPTVLPERRLWPRYLLLGWAFPVLFVVPWGFARAHLENTGCWTTNGNKKIWWIIRGPMMLC    281 - 350
VTVNFFIFLKILKLLISKLKAHQMCFRDYKYRLAKSTLVLIPLLGVHEILFSFITDDQVEGFAKLIRLFI    351 - 420
QLTLSSFHGFLVALQYGFANGEVKAELRKYWVRFLLARHSGCRACVLGKDFRFLGKCPKKLSEGDGAEKL    421 - 490
RKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTMANTMEEILEESEI           491 - 553
//

Text Mined References (25)

PMID Year Title