Property Summary

NCBI Gene PubMed Count 154
PubMed Score 684.60
PubTator Score 848.84

Knowledge Summary

Patent (21,409)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.300 1.3e-03
osteosarcoma 1.578 8.6e-06

Protein-protein Interaction (1)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
624148 confirmatory 2 / 47 / 1231 qHTS of GLP-1 Receptor Agonists: LOPAC Validation
624152 summary 0 / 0 / 0 qHTS of GLP-1 Receptor Agonists: Summary
624172 confirmatory 23 / 2833 / 372412 qHTS of GLP-1 Receptor Agonists
624417 confirmatory 6432 / 80185 / 321735 qHTS of GLP-1 Receptor Inverse Agonists (Inhibition Mode)
624421 summary 0 / 0 / 0 qHTS of GLP-1 Receptor Inverse Agonists: Summary
743262 confirmatory 23 / 112 / 1176 qHTS of GLP-1 Receptor Agonists: Hit Validation

Gene RIF (100)

PMID Text
27059958 The molecular dynamics simulations of wild-type and mutant GLP-1R.ligand complexes provided molecular insights into GLP-1R-specific recognition mechanisms for the N terminus of GLP-1 by residues in the 7TM pocket and explained how glucagon-mimicking GLP-1 mutants restored binding affinity for (glucagon receptor -mimicking) GLP-1R mutants.
26598711 NMR-determined structure of a high-potency cyclic conformationally-constrained 11-residue analogue of GLP-1 was also docked into the receptor-binding site.
26384381 Retinal GLP1R expression was similar in patients with diabetes and healthy controls.
26272612 a novel GLP1R Interacting Protein ATP6ap2
26238361 although GLP-1R is not an independent prognostic factor in PDAC patients, it appears to have some implications for pancreatic ductal adenocarcinoma metastatic ability
26198634 This study reveals the glucagon receptor as a previously unidentified target for GLP-1 receptor agonists and highlights a role for RAMP2 in regulating its pharmacology.
26116235 these findings demonstrate the hGLP-1R has distinct regions within the C-terminal domain required for its cell surface expression, activity and agonist-induced internalisation.
26080318 168Ser (rs6923761) was nominally associated with alcohol use disorder. The 168 Ser/Ser genotype was associated with increased alcohol administration, and with higher BOLD response in the right globus pallidus.
26015316 Lack of association of rs6923761 GLP-1 R polymorphism with weight loss.
25991051 GLP-1R rs10305420 polymorphism explained some of the inter-individual differences in response to liraglutide regarding weight loss in obese PCOS women.
25915883 reduced level in renal arteries of hypertensive patients
25903129 The potency of GLP-1 is enhanced by the endocannabinoid-like lipids oleoylethanolamide and 2-oleoylglycerol.
25785276 response to GLP-1 analogue in patients with poorly controlled type 2 diabetes is not statistically correlated with GLP1R polymorphism
25669907 Glucagon-like receptor 1 agonists and DPP-4 inhibitors: potential therapies for the treatment of stroke.
25561730 Data show that Ile(196), Met(233) and Asn(302) of glucagon-like peptide 1 receptor (GLP1R) interact with His(1) and Thr(7) of glucagon-like peptide-1 (GLP-1).
25502804 The N-terminus of hGLP-1R regulates receptor trafficking and maturation.
25483438 Hyperglycemia decreases GLP-1R expression in retinal pigment epithelial cells.
25451942 Moreover, cross-talk between the two incretin receptors GLP-1R and GIPR is shown to alter receptor trafficking with functional consequences for GLP-1R signaling.
25376673 Our study showed a higher weight loss 12 and 18 months after bariatric surgery in GG variant than A allele carriers. The biochemical parameters and cardiovascular comorbidity rates improved similarly in both genotypes.
25376528 The GLP-1 receptor variant rs6923761 was found to be associated with decreased weight and anthropometric parameters in A allele carriers with and without MS. MS or its components were not associated with this polymorphism in obese adults.
25330813 Data indicate that the role of the SP (signal peptide) sequence is to promote the expression of GLP-1R (glucagon-like peptide-1 receptor).
25200998 An association was found between the rs6923761 GLP-1 receptor polymorphism and basal GLP-1 levels in diabetes mellitus type 2 patients.
25119061 Authors found distinct expression patterns of GLP1R and DPP-IV depending on the neuroendocrine cell types in P-NEN and the anatomical sites in GI-NEN.
25071023 GLP1R activation modulated food related responses in appetite and reward areas of the brain in humans.
24969551 Lack of association of rs6923761 GLP-1 R polymorphism with weight loss after hypocaloric diets; better anthropometric parameters in obese subjects with the mutant allele (A) of rs6923761 GLP-1 R polymorphism.
24878048 These data demonstrate that the defective function of the incretin axis in type 2 diabetes may also result from decreased GLP-1R expression in its extrapancreatic target organs.
24687535 data showed a relationship of metabolic parameters with the mutant allele (A) of rs6923761 GLP-1 receptor polymorphism in obese females; BMI weight, fat mass, waist circumference, triglycerides, leptin, resistin and IL-6 serum levels were lower in subjects with A alelle than non-A allele subjects
24679032 Our aim was to analyze the effects of rs6923761 GLP-1 receptor polymorphism on body weight, cardiovascular risk factors and serum adipokine levels in morbid obese patients
24624910 The significant gene-gene interaction between rs13429709 and rs2268639 in GLP1R.
24577752 GLP-1R expression is not a risk prognostic factor in intrahepatic cholangiocarcinoma.
24467746 analysis of expression of GLP1R in pancreas, kidney, lung and heart
24334921 no association between the rs6923761 GLP-1R polymorphism and body weight response after two different hypocaloric diets
24326362 Data indicate that glucagon-like peptide 1 receptor (GLP-1R) might become a molecular target for treatment of metastatic pancreatic neuroendocrine tumors (PNETs).
24307763 GLP-1R is expressed in retinal pigment epithelial cells
24275181 GLP-1R is shown to be a recycling receptor.
23879380 study shows that while BMI and HbA1c are positively associated with DNA methylation levels of GLP1R, its expression is negatively associated with DNA methylation of GLP1R in pancreatic islets
23864651 A novel GLP-1R-protein interactome was generated, identifying several interactors that suppress GLP-1R signaling.
23806684 LOX-1 may play a bridging role in GLP-1 activation and reactive oxygen species interaction.
23803499 Determined is the expression of GLP-1R in different regions of human stomach mucosa and its specific cellular association and distribution within gastric glands.
23592482 triggers cAMP generation both in plasma GLP1R membrane and in endosomes, which has implications for receptor-mediated regulation of insulin secretion
23362875 GLP1R is expressed in human psoriasis plaques but not in cultured keratinocytes
23091034 GLP-1R dimerization is important for control of signal bias.
22693487 GLP-1R may have a role in different subtypes of thyroid cancer [review]
22492091 Suggest a possible direct effect of glucagon-like peptide-1 receptor agonist exenatide on intestinal lipoprotein particle production.
22412906 Functional expression of a GIP receptor mutant lacking N-glycosylation is rescued by co-expressed wild type GLP1 receptor, which suggests formation of a GIP-GLP1 receptor heteromer.
22147710 a critical role of ECL2 of the GLP-1R in the activation transition(s) of the receptor and the importance of this region in the determination of both GLP-1 peptide- and pathway-specific effects.
22147709 a critical role of ECL2 of the GLP-1R in the activation transition of the receptor by peptide agonists.
22112810 Most of the somatostatin receptor-negative neuroendocrine tumors and GLP-1 receptor-negative malignant insulinomas are GIP receptor positive.
22105074 Evolutionarily conserved residues at glucagon-like peptide-1 (GLP-1) receptor core confer ligand-induced receptor activation
22079758 analysis of how a pentapeptide agonist at interacts with the glucagon-like peptide-1 receptor
22031513 In humans, neoplastic and hyperplastic lesions of thyroid C cells express the GLP-1 receptor.
21952200 betaarr2 competes with GRK2 for interaction with the activated and GRK phosphorylated GLP-1R, suggesting a new role of betaarr2 in regulating the orchestration of GRK2 functionality
21868452 Data show important roles in ligand binding and receptor activation of conserved residues within the transmembrane domain of the GLP-1R.
21862620 evidence for the presence of GLP-1R in adipose tissue and show that its mRNA and protein expressions are increased in visceral adipose depots from morbidly obese patients with a high degree of insulin resistance
21745271 Glucagon-like peptide-1 receptor activation stimulates hepatic lipid oxidation and restores hepatic signalling alteration induced by a high-fat diet in nonalcoholic steatohepatitis.
21744074 GLP-1 signaling through GLP-1 receptor modulates cytokine production in natural killer T-cells; GLP-1 signaling appears to be important in psoriasis patients with type 2 diabetes mellitus (e.g., GLP-1 mimetic analogs may be used therapeutically).
21663496 greater proportion of patients with type 2 diabetes can achieve the HbA(1c) goal <7% with GLP-1 agonists compared to placebo or other antidiabetic drugs; in absolute terms, exenatide LAR was best for the attainment of the HbA(1c) goal.
21616920 regulation of GLP-1R function is complex with endogenous peptides that interact with the receptor, including full-length and truncated forms of GLP-1 that can exist in an amidated form (GLP-1(1-36)NH and GLP-1(7-36)NH) and related peptide oxyntomodulin
21562063 A GLP-1 receptor agonist liraglutide inhibits endothelial cell dysfunction and vascular adhesion molecule expression in an ApoE-/- mouse model.
21095545 Targeting GLP-1R by (111)In-DOTA-exendin-4 or (111)In-DPTA-exendin-4 offers a new approach that permits the successful localization of small benign insulinomas.
21046358 cAMP-mediated pathways are modelled by glucose, and downregulation of the calcium-sensitive ADCY8 plays a central role herein, including signalling via the GLP1R.
20835917 In contrast to insulinoma, hyperinsulinaemic hypoglycaemia after gastric bypass surgery is not accompanied by overexpression of GLP-1 receptor in individual islets.
20823098 Low molecular weight pyrimidine-based compounds can activate the GLP-1 receptor and stimulate glucose-dependent insulin secretion.
20805279 Variation in GLP1R may alter insulin secretion in response to exogenous GLP-1.
20805279 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20690636 Recombinant expression, in vitro refolding, and biophysical characterization of the human glucagon-like peptide-1 receptor
20649595 The major determinant of exendin-4/glucagon-like peptide 1 differential affinity at the rat glucagon-like peptide 1 receptor N-terminal domain is a hydrogen bond from SER-32 of exendin-4.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20529866 analysis of the amino-terminal region of glucagon-like peptide 1 and its receptor, a region critical for biological activity
20483198 Our results identify associations between a novel genetic variant of GLP-1R and hypothalamus-pituitary-adrenal (HPA) axis regulation.
20483198 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20452396 Exendin-4 stimulates proliferation of coronary artery endothelial cells via a GLP-1R dependent mechanism.
20374430 The data of this study confirmed that GLP-1R agonists have clinical potential in treating neuronal stresses relevant to neurodegenerative conditions.
20347207 In prolonged ventricular fibrillation followed by resuscitation, myocardial microcirculatory function was enhanced with administration of GLP-1. Treatment was not associated with significant improvement in post-resuscitation myocardial function.
20225248 GLP-1R is present on human hepatocytes.
20002095 the putative signal peptide of GLP-1R was cleaved during synthesis and processing of the receptor; while cleavage was not essential for receptor synthesis, it was obligatory for effective processing and trafficking to the plasma membrane
19913121 Observational study of gene-disease association. (HuGE Navigator)
19890029 GLP-1 receptor scintigraphy is a novel tool to facilitate the detection of insulinomas.
19861722 The crystal structure of the extracellular domain of GLP-1 receptor in complex with GLP-1 was solved to 2.1 A resolution.
19859570 GFP-GLP-1 receptor is weakly expressed in the plasma membranes and is functionally coupled to adenylyl cyclase via heterotrimeric G-proteins, similarly as its wild type.
19820010 In vivo GLP-1R imaging is an innovative, noninvasive diagnostic approach that successfully localizes small insulinomas.
19815559 analysis of the molecular basis of natural agonist ligand binding to the GLP1 receptor
19755420 Data demonstrate that the GLP-1R agonist, exendin-4, significantly improves the efficiency of PDX-1-mediated transdifferentiation.
19386626 Decreased TCF7L2 protein levels in type 2 diabetes mellitus correlate with downregulation of GLP-1R and GIP-R.
19077438 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18541709 Our data suggest that the GLP-1 receptor is restricted to the pancreatic beta cells.
18372345 Structural basis of endogenous agonist activation of family B G protein-coupled receptors.
18287102 analysis of the crystal structure of the ligand-bound glucagon-like peptide-1 receptor extracellular domain
17475961 For GLP-1 receptor scintigraphy, a low-background signal can be expected, on the basis of the low receptor expression in the normal tissues surrounding tumors.
17444618 results suggest that the differential affinity of nGLP-1R is explained almost entirely by divergent residues in the central part of the ligands: Leu10-Gly30 of Exendin-4 and Val16-Arg36 of GLP-1.
16931572 The interaction of the GLP-1R with caveolin-1 regulates subcellular localization, trafficking, and signaling activity.
16644694 GLP-1R stimulation does not modify the growth or survival of human pancreatic cancer cells.
15975668 glucagon-like peptide-1 receptor polymorphism results in reduced agonist responsiveness
15686481 Experimental evidence indicates that the GLP-1 receptor gene is expressed in human brain as a protein, with binding properties similar to those of the GLP-1R located in peripheral tissues.
15528268 analysis of the glucagon-like peptide-1 receptor beta-arrestin 2 interaction
15364163 Observational study of gene-disease association. (HuGE Navigator)
15364163 Missenses mutations in Japaneses type 2 diabetes patients.
12034449 In vitro folding, functional characterization, and disulfide pattern of the extracellular domain

AA Sequence

MAGAPGPLRLALLLLGMVGRAGPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYA      1 - 70
CWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQ     71 - 140
LLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYSTAAQ    141 - 210
QHQWDGLLSYQDSLSCRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLF    211 - 280
VVPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKTDIKCRLA    281 - 350
KSTLTLIPLLGTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERW    351 - 420
RLEHLHIQRDSSMKPLKCPTSSLSSGATAGSSMYTATCQASCS                               421 - 463
//

Text Mined References (156)

PMID Year Title
27068973 2016 The complexity of signalling mediated by the glucagon-like peptide-1 receptor.
27059958 2016 Structural Determinants of Binding the Seven-transmembrane Domain of the Glucagon-like Peptide-1 Receptor (GLP-1R).
27059816 2016 Differential effects of once-weekly glucagon-like peptide-1 receptor agonist dulaglutide and metformin on pancreatic ?-cell and insulin sensitivity during a standardized test meal in patients with type 2 diabetes.
27059784 2016 Allosteric Optical Control of a Class B G-Protein-Coupled Receptor.
27043162 2016 Postprandial plasma glucose effects of once-weekly albiglutide for the treatment of type 2 diabetes.
27042424 Glucagon-like peptide-1 receptor agonists in the treatment of type 2 diabetes: Past, present, and future.
27038451 2016 Acute renal effects of the GLP-1 receptor agonist exenatide in overweight type 2 diabetes patients: a randomised, double-blind, placebo-controlled trial.
27037787 2016 Adverse effects of incretin-based therapies on major cardiovascular and arrhythmia events: meta-analysis of randomized trials.
27037706 2016 Safety and Tolerability of Glucagon-Like Peptide-1 Receptor Agonists Utilizing Data from the Exenatide Clinical Trial Development Program.
27013681 2016 Astrocytes Regulate GLP-1 Receptor-Mediated Effects on Energy Balance.
26975372 2016 Positive Allosteric Modulation of the Glucagon-like Peptide-1 Receptor by Diverse Electrophiles.
26969516 2016 Non-insulin drugs to treat hyperglycaemia in type 1 diabetes mellitus.
26968296 2016 Endocrine and metabolic effects of Glucagon like peptide 1 receptor agonists (GLP1RA).
26936963 2016 Glucagon-Like Peptide 1 Receptor Activation Attenuates Platelet Aggregation and Thrombosis.
26936426 2016 Efficacy and safety of liraglutide, a once-daily human glucagon-like peptide-1 analogue, in Latino/Hispanic patients with type 2 diabetes: post hoc analysis of data from four phase III trials.
26886440 2016 A Network Meta-analysis Comparing Exenatide Once Weekly with Other GLP-1 Receptor Agonists for the Treatment of Type 2 Diabetes Mellitus.
26874994 2016 Differential expression network analysis for diabetes mellitus type 2 based on expressed level of islet cells.
26847401 2016 Low incidence of anti-drug antibodies in patients with type 2 diabetes treated with once-weekly glucagon-like peptide-1 receptor agonist dulaglutide.
26835799 2016 The changing therapeutic armamentarium for patients with type 1 diabetes.
26803771 2016 GLP-1 Agonists and Blood Pressure: A Review of the Evidence.
26798195 2016 Exendin-4 promotes extracellular-superoxide dismutase expression in A549 cells through DNA demethylation.
26795291 2016 Glucagon-Like Peptide-1 Receptor PET/CT with 68Ga-NOTA-Exendin-4 for Detecting Localized Insulinoma: A Prospective Cohort Study.
26795287 2016 Noninvasive Imaging of Islet Transplants with 111In-Exendin-3 SPECT/CT.
26787264 2016 Treatment intensification in patients with inadequate glycemic control on basal insulin: rationale and clinical evidence for the use of short-acting and other glucagon-like peptide-1 receptor agonists.
26782560 2015 Glucagon-like peptide-1 receptor agonists inhibit hepatic stellate cell activation by blocking the p38 MAPK signaling pathway.
26773924 2016 Differential effects of GLP-1 receptor agonist on foam cell formation in monocytes between non-obese and obese subjects.
26700562 2016 A Hydrogen-Bonded Polar Network in the Core of the Glucagon-Like Peptide-1 Receptor Is a Fulcrum for Biased Agonism: Lessons from Class B Crystal Structures.
26694823 2016 Glucagon-Like Peptide-1 Receptor Agonists for Type 2 Diabetes: A Clinical Update of Safety and Efficacy.
26679229 2016 Inhibiting receptor for advanced glycation end product (AGE) and oxidative stress involved in the protective effect mediated by glucagon-like peptide-1 receptor on AGE induced neuronal apoptosis.
26672638 2016 Decreased Hypothalamic Glucagon-Like Peptide-1 Receptor Expression in Type 2 Diabetes Patients.
26661514 2016 Once-weekly glucagon-like peptide-1 receptor agonist dulaglutide significantly decreases glycated haemoglobin compared with once-daily liraglutide in Japanese patients with type 2 diabetes: 52?weeks of treatment in a randomized phase III study.
26655814 2016 Evidence for glucagon-like peptide-1 receptor signaling to activate ATP-sensitive potassium channels in pancreatic beta cells.
26640129 2016 Glucagon-like peptide-1 receptor agonist exenatide has no acute effect on MRI-measured exocrine pancreatic function in patients with type 2 diabetes: a randomized trial.
26636423 2016 Acute renal haemodynamic effects of glucagon-like peptide-1 receptor agonist exenatide in healthy overweight men.
26598711 2015 The peptide agonist-binding site of the glucagon-like peptide-1 (GLP-1) receptor based on site-directed mutagenesis and knowledge-based modelling.
26384381 2016 Topical Administration of GLP-1 Receptor Agonists Prevents Retinal Neurodegeneration in Experimental Diabetes.
26381270 2015 Altered intestinal neuroendocrine gene expression in humans with obesity.
26272612 2015 A Novel GLP1 Receptor Interacting Protein ATP6ap2 Regulates Insulin Secretion in Pancreatic Beta Cells.
26238361 2015 Significance of expression of glucagon-like peptide 1 receptor in pancreatic cancer.
26198634 2015 Modulation of Glucagon Receptor Pharmacology by Receptor Activity-modifying Protein-2 (RAMP2).
26116235 2015 Distinct regions in the C-Terminus required for GLP-1R cell surface expression, activity and internalisation.
26080318 2015 The glucagon-like peptide-1 receptor as a potential treatment target in alcohol use disorder: evidence from human genetic association studies and a mouse model of alcohol dependence.
26015316 2015 Effects of a high-protein/low-carbohydrate versus a standard hypocaloric diet on adipocytokine levels and cardiovascular risk factors during 9 months, role of rs6923761 gene variant of glucagon-like peptide 1 receptor.
25991051 2015 Genetic variability in GLP-1 receptor is associated with inter-individual differences in weight lowering potential of liraglutide in obese women with PCOS: a pilot study.
25915883 2015 Protein kinase C? mediates downregulated expression of glucagon-like peptide-1 receptor in hypertensive rat renal arteries.
25903129 2015 Modulation of Glucagon-like Peptide-1 (GLP-1) Potency by Endocannabinoid-like Lipids Represents a Novel Mode of Regulating GLP-1 Receptor Signaling.
25785276 2015 Polymorphisms of GLP-1 receptor gene and response to GLP-1 analogue in patients with poorly controlled type 2 diabetes.
25669907 2015 Glucagon-like receptor 1 agonists and DPP-4 inhibitors: potential therapies for the treatment of stroke.
25561730 2015 Ligand binding pocket formed by evolutionarily conserved residues in the glucagon-like peptide-1 (GLP-1) receptor core domain.
25502804 2014 The regions within the N-terminus critical for human glucagon like peptide-1 receptor (hGLP-1R) cell surface expression.
25483438 2015 Hyperglycemia-induced GLP-1R downregulation causes RPE cell apoptosis.
25451942 2015 Functional consequences of glucagon-like peptide-1 receptor cross-talk and trafficking.
25416956 2014 A proteome-scale map of the human interactome network.
25376673 2014 Role of the rs6923761 gene variant in glucagon-like peptide 1 receptor gene on cardiovascular risk factors and weight loss after biliopancreatic diversion surgery.
25376528 2014 Relation of the rs6923761 gene variant in glucagon-like peptide 1 receptor to metabolic syndrome in obese subjects.
25330813 2014 The putative signal peptide of glucagon-like peptide-1 receptor is not required for receptor synthesis but promotes receptor expression.
25200998 2015 Role of rs6923761 gene variant in glucagon-like peptide 1 receptor in basal GLP-1 levels, cardiovascular risk factor and serum adipokine levels in naïve type 2 diabetic patients.
25119061 2014 The expression of glucagon-like peptide-1 receptor and dipeptidyl peptidase-IV in neuroendocrine neoplasms of the pancreas and gastrointestinal tract.
25071023 2014 GLP-1 receptor activation modulates appetite- and reward-related brain areas in humans.
24969551 2014 Cardiovascular risk factors and adipocytokines levels after two hypocaloric diets with different fat distribution in obese subjects and rs6923761 gene variant of glucagon-like peptide 1 receptor.
24878048 2014 Reduced GLP-1R expression in gastric glands of patients with type 2 diabetes mellitus.
24687535 2015 Relation of the rs6923761 gene variant in glucagon-like peptide 1 receptor with weight, cardiovascular risk factor, and serum adipokine levels in obese female subjects.
24679032 2014 [Roles of rs 6923761 gene variant in glucagon-like peptide 1 receptor on weight, cardiovascular risk factor and serum adipokine levels in morbid obese patients].
24624910 2014 Genetic variation in the GCG and in the GLP1R genes and antipsychotic-induced weight gain.
24577752 2014 Expression of GLP-1R protein and its clinical role in intrahepatic cholangiocarcinoma tissues.
24467746 2014 GLP-1 receptor localization in monkey and human tissue: novel distribution revealed with extensively validated monoclonal antibody.
24334921 2013 Evaluation of weight loss and adipocytokine levels after two hypocaloric diets with different macronutrient distribution in obese subjects with the rs6923761 gene variant of glucagon-like peptide 1 receptor.
24326362 2014 Expression of glucagon-like Peptide 1 receptor and its effects on biologic behavior in pancreatic neuroendocrine tumors.
24307763 2013 Retinal pigment epithelial cells express a functional receptor for glucagon-like peptide-1 (GLP-1).
24275181 2014 Real-time trafficking and signaling of the glucagon-like peptide-1 receptor.
23879380 2013 DNA methylation of the glucagon-like peptide 1 receptor (GLP1R) in human pancreatic islets.
23864651 2013 The identification of novel proteins that interact with the GLP-1 receptor and restrain its activity.
23806684 2013 LOX-1, a bridge between GLP-1R and mitochondrial ROS generation in human vascular smooth muscle cells.
23803499 2013 GLP-1 receptor is expressed in human stomach mucosa: analysis of its cellular association and distribution within gastric glands.
23592482 2013 Glucagon-like peptide-1 receptor-mediated endosomal cAMP generation promotes glucose-stimulated insulin secretion in pancreatic ?-cells.
23362875 2013 Increased expression of glucagon-like peptide-1 receptors in psoriasis plaques.
23091034 2012 Glucagon-like peptide-1 receptor dimerization differentially regulates agonist signaling but does not affect small molecule allostery.
22693487 2012 A review on the association between glucagon-like peptide-1 receptor agonists and thyroid cancer.
22492091 2012 Exenatide, a glucagon-like peptide-1 receptor agonist, acutely inhibits intestinal lipoprotein production in healthy humans.
22412906 2012 Regulation of GIP and GLP1 receptor cell surface expression by N-glycosylation and receptor heteromerization.
22147710 2012 Second extracellular loop of human glucagon-like peptide-1 receptor (GLP-1R) has a critical role in GLP-1 peptide binding and receptor activation.
22147709 2012 Second extracellular loop of human glucagon-like peptide-1 receptor (GLP-1R) differentially regulates orthosteric but not allosteric agonist binding and function.
22112810 2012 Glucose-dependent insulinotropic polypeptide receptors in most gastroenteropancreatic and bronchial neuroendocrine tumors.
22105074 2012 Evolutionarily conserved residues at glucagon-like peptide-1 (GLP-1) receptor core confer ligand-induced receptor activation.
22079758 2012 Site of action of a pentapeptide agonist at the glucagon-like peptide-1 receptor. Insight into a small molecule agonist-binding pocket.
22031513 2012 Glucagon like peptide-1 receptor expression in the human thyroid gland.
21952200 2011 Beta-arrestin2 as a competitor for GRK2 interaction with the GLP-1 receptor upon receptor activation.
21901419 2012 Glucagon like-peptide-1 receptor is covalently modified by endogenous mono-ADP-ribosyltransferase.
21868452 2011 Residues within the transmembrane domain of the glucagon-like peptide-1 receptor involved in ligand binding and receptor activation: modelling the ligand-bound receptor.
21862620 2011 Study of the potential association of adipose tissue GLP-1 receptor with obesity and insulin resistance.
21745271 2011 Glucagon-like peptide-1 receptor activation stimulates hepatic lipid oxidation and restores hepatic signalling alteration induced by a high-fat diet in nonalcoholic steatohepatitis.
21744074 2011 Glucagon-like peptide-1 (GLP-1) and the regulation of human invariant natural killer T cells: lessons from obesity, diabetes and psoriasis.
21663496 2011 GLP-1 receptor agonists and HBA1c target of <7% in type 2 diabetes: meta-analysis of randomized controlled trials.
21616920 2011 Polymorphism and ligand dependent changes in human glucagon-like peptide-1 receptor (GLP-1R) function: allosteric rescue of loss of function mutation.
21562063 2011 A GLP-1 receptor agonist liraglutide inhibits endothelial cell dysfunction and vascular adhesion molecule expression in an ApoE-/- mouse model.
21095545 2010 Glucagonlike peptide-1 receptor: an example of translational research in insulinomas: a review.
21046358 2011 Adenylyl cyclase 8 is central to glucagon-like peptide 1 signalling and effects of chronically elevated glucose in rat and human pancreatic beta cells.
20869417 2010 Functional coupling of Cys-226 and Cys-296 in the glucagon-like peptide-1 (GLP-1) receptor indicates a disulfide bond that is close to the activation pocket.
20835917 2010 Glucagon-like peptide-1 (GLP-1) receptors are not overexpressed in pancreatic islets from patients with severe hyperinsulinaemic hypoglycaemia following gastric bypass.
20823098 2010 Novel small molecule glucagon-like peptide-1 receptor agonist stimulates insulin secretion in rodents and from human islets.
20805279 2010 Common genetic variation in GLP1R and insulin secretion in response to exogenous GLP-1 in nondiabetic subjects: a pilot study.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20690636 2010 Recombinant expression, in vitro refolding, and biophysical characterization of the human glucagon-like peptide-1 receptor.
20649595 2010 The major determinant of exendin-4/glucagon-like peptide 1 differential affinity at the rat glucagon-like peptide 1 receptor N-terminal domain is a hydrogen bond from SER-32 of exendin-4.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20529866 2010 Spatial approximations between residues 6 and 12 in the amino-terminal region of glucagon-like peptide 1 and its receptor: a region critical for biological activity.
20483198 2010 Glucagon-like peptide-1 receptor gene polymorphism (Leu260Phe) is associated with morning cortisol in preschoolers.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20452396 2010 Exendin-4 stimulates proliferation of human coronary artery endothelial cells through eNOS-, PKA- and PI3K/Akt-dependent pathways and requires GLP-1 receptor.
20374430 2010 Enhancing the GLP-1 receptor signaling pathway leads to proliferation and neuroprotection in human neuroblastoma cells.
20347207 2010 Glucagon-like peptide-1 (GLP-1) attenuates post-resuscitation myocardial microcirculatory dysfunction.
20225248 2010 Glucagon-like peptide-1 receptor is present on human hepatocytes and has a direct role in decreasing hepatic steatosis in vitro by modulating elements of the insulin signaling pathway.
20002095 2010 Role of the signal peptide in the synthesis and processing of the glucagon-like peptide-1 receptor.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19890029 2009 For insulinomas, no place to hide.
19861722 2010 Crystal structure of glucagon-like peptide-1 in complex with the extracellular domain of the glucagon-like peptide-1 receptor.
19859570 2009 Functional characterization of N-terminally GFP-tagged GLP-1 receptor.
19820010 2009 Glucagon-like peptide-1 receptor imaging for localization of insulinomas.
19815559 2009 Molecular basis of glucagon-like peptide 1 docking to its intact receptor studied with carboxyl-terminal photolabile probes.
19755420 2009 Exendin-4 promotes liver cell proliferation and enhances the PDX-1-induced liver to pancreas transdifferentiation process.
19386626 2009 Decreased TCF7L2 protein levels in type 2 diabetes mellitus correlate with downregulation of GIP- and GLP-1 receptors and impaired beta-cell function.
19077438 2009 Analysis of 30 genes (355 SNPS) related to energy homeostasis for association with adiposity in European-American and Yup'ik Eskimo populations.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18541709 2008 Expression of the GLP-1 receptor in mouse, rat, and human pancreas.
18372345 2008 Insights into the structural basis of endogenous agonist activation of family B G protein-coupled receptors.
18287102 2008 Crystal structure of the ligand-bound glucagon-like peptide-1 receptor extracellular domain.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17475961 2007 GLP-1 receptor expression in human tumors and human normal tissues: potential for in vivo targeting.
17444618 2007 Differential structural properties of GLP-1 and exendin-4 determine their relative affinity for the GLP-1 receptor N-terminal extracellular domain.
16931572 2006 Caveolin-1 regulates cellular trafficking and function of the glucagon-like Peptide 1 receptor.
16644694 2006 Activation of glucagon-like peptide-1 receptor signaling does not modify the growth or apoptosis of human pancreatic cancer cells.
15975668 2005 A human glucagon-like peptide-1 receptor polymorphism results in reduced agonist responsiveness.
15686481 2005 The expression of GLP-1 receptor mRNA and protein allows the effect of GLP-1 on glucose metabolism in the human hypothalamus and brainstem.
15670850 2005 Calmodulin interacts with the cytoplasmic tails of the parathyroid hormone 1 receptor and a sub-set of class b G-protein coupled receptors.
15528268 2005 Characterization of glucagon-like peptide-1 receptor beta-arrestin 2 interaction: a high-affinity receptor phenotype.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15364163 2004 Five missense mutations in glucagon-like peptide 1 receptor gene in Japanese population.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
12034449 2002 In vitro folding, functional characterization, and disulfide pattern of the extracellular domain of human GLP-1 receptor.
11116211 2000 Characterization of glucagon-like peptide-1 receptor-binding determinants.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10990079 2000 Glucagon receptors on human islet cells contribute to glucose competence of insulin release.
10382665 1999 Structure of the integral membrane domain of the GLP1 receptor.
9213353 1997 Cloning and characterization of the 5' flanking sequences (promoter region) of the human GLP-1 receptor gene.
8405712 1993 Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor.
8404634 1993 Cloning and functional expression of the human glucagon-like peptide-1 (GLP-1) receptor.
8392011 1993 Human glucagon-like peptide-1 receptor gene. Localization to chromosome band 6p21 by fluorescence in situ hybridization and linkage of a highly polymorphic simple tandem repeat DNA polymorphism to other markers on chromosome 6.
8216285 1993 Cloning and functional expression of a human glucagon-like peptide-1 receptor.
8194659 1994 Human glucagon-like peptide-1 receptor gene in NIDDM. Identification and use of simple sequence repeat polymorphisms in genetic analysis.
8112494 1994 Detection of the human glucagon-like peptide 1(7-36) amide receptor on insulinoma-derived cell membranes.
7958545 1994 Non-linkage of the glucagon-like peptide 1 receptor gene with maturity onset diabetes of the young.
7843404 1995 Tissue-specific expression of the human receptor for glucagon-like peptide-I: brain, heart and pancreatic forms have the same deduced amino acid sequences.
7589461 1995 Stimulation of cloned human glucagon-like peptide 1 receptor expressed in HEK 293 cells induces cAMP-dependent activation of calcium-induced calcium release.
7517895 1994 Signal transduction of the GLP-1-receptor cloned from a human insulinoma.