Property Summary

Ligand Count 123
NCBI Gene PubMed Count 173
PubMed Score 820.54
PubTator Score 848.84

Knowledge Summary

Patent (21,409)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.578 8.6e-06
psoriasis 1.300 1.3e-03

Gene RIF (120)

AA Sequence

MAGAPGPLRLALLLLGMVGRAGPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYA      1 - 70
CWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQ     71 - 140
LLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYSTAAQ    141 - 210
QHQWDGLLSYQDSLSCRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLF    211 - 280
VVPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKTDIKCRLA    281 - 350
KSTLTLIPLLGTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERW    351 - 420
RLEHLHIQRDSSMKPLKCPTSSLSSGATAGSSMYTATCQASCS                               421 - 463
//

Text Mined References (177)

PMID Year Title