Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.71
PubTator Score 10.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
astrocytoma 1.500 7.0e-19
glioblastoma 1.800 1.4e-04
oligodendroglioma 1.400 3.9e-10
osteosarcoma -1.939 2.0e-03
chronic lymphosyte leukemia -1.300 1.6e-07
posterior fossa group A ependymoma 1.900 4.5e-08
cystic fibrosis -2.808 3.1e-07
primary pancreatic ductal adenocarcinoma 1.258 2.6e-03
tuberculosis 1.200 3.9e-06
non-small cell lung cancer -2.403 6.2e-27
intraductal papillary-mucinous carcinoma... -2.100 3.6e-04
intraductal papillary-mucinous neoplasm ... -1.600 1.3e-02
Hydrolethalus syndrome -1.365 7.3e-03
active ulcerative colitis -2.023 6.4e-03
interstitial cystitis 1.300 4.0e-04
lung adenocarcinoma -1.700 8.0e-10
pediatric high grade glioma 1.700 1.8e-05
pilocytic astrocytoma 1.500 8.4e-05
aldosterone-producing adenoma -1.009 1.9e-02
Polycystic Ovary Syndrome -1.133 3.3e-02
lung carcinoma -3.400 3.9e-37
progressive supranuclear palsy -1.100 7.6e-03
Breast cancer -1.200 2.9e-04
ovarian cancer 1.800 2.1e-05
pancreatic cancer 1.500 1.2e-03

Gene RIF (4)

PMID Text
24204846 Hypoxia promotes epithelial-mesenchymal transition of hepatocellular carcinoma cells via inducing GLIPR-2 expression.
23516513 GLIPR-2 overexpression in HK-2 cells can potentiate EMT-like processes in this cell type through the ERK1/2 signaling pathway
22560898 the charge properties of the lipid bilayer can regulate GAPR-1 dynamics as a potential mechanism to modulate GAPR-1 function
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWA      1 - 70
SYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVV     71 - 140
NEGFFEENVLPPKK                                                            141 - 154
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24204846 2013 Hypoxia promotes epithelial--mesenchymal transition of hepatocellular carcinoma cells via inducing GLIPR-2 expression.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23516513 2013 GLIPR-2 overexpression in HK-2 cells promotes cell EMT and migration through ERK1/2 activation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22560898 2012 Interaction of GAPR-1 with lipid bilayers is regulated by alternative homodimerization.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15123429 2004 Structural analysis of the human Golgi-associated plant pathogenesis related protein GAPR-1 implicates dimerization as a regulatory mechanism.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12137952 2002 Cloning and characterization of a human novel gene C9orf19 encoding a conserved putative protein with an SCP-like extracellular protein domain.
11865038 2002 Identification and characterization of a novel human plant pathogenesis-related protein that localizes to lipid-enriched microdomains in the Golgi complex.