Property Summary

NCBI Gene PubMed Count 8
PubMed Score 38.47
PubTator Score 9.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
ependymoma -3.400 2.5e-02
oligodendroglioma -1.200 1.3e-05
osteosarcoma -2.777 3.0e-03
sonic hedgehog group medulloblastoma -2.600 5.0e-04
atypical teratoid/rhabdoid tumor -2.100 8.7e-05
Atopic dermatitis -1.700 2.2e-03
adrenocortical carcinoma -1.301 2.7e-02
non-small cell lung cancer -3.177 1.1e-29
sarcoidosis -1.900 1.6e-02
fibroadenoma -1.100 3.5e-02
lung adenocarcinoma -1.900 4.0e-18
lung carcinoma -3.000 2.5e-19
Pick disease -2.300 7.6e-03
progressive supranuclear palsy -2.200 2.8e-02
ductal carcinoma in situ -2.100 1.4e-03
invasive ductal carcinoma -2.500 5.8e-03
ovarian cancer 1.700 1.8e-05

Gene RIF (2)

PMID Text
22462667 gliomedin, NF186, and contactin are novel target antigens in Guillain-Barre syndrome
22009740 Fibronectin type III-like domains of neurofascin-186 protein mediate gliomedin binding and its clustering at the developing nodes of Ranvier

AA Sequence

MARGAEGGRGDAGWGLRGALAAVALLSALNAAGTVFALCQWRGLSSALRALEAQRGREQREDSALRSFLA      1 - 70
ELSRAPRGASAPPQDPASSARNKRSHSGEPAPHIRAESHDMLMMMTYSMVPIRVMVDLCNSTKGICLTGP     71 - 140
SGPPGPPGAGGLPGHNGLDGQPGPQGPKGEKGANGKRGKMGIPGAAGNPGERGEKGDHGELGLQGNEGPP    141 - 210
GQKGEKGDKGDVSNDVLLAGAKGDQGPPGPPGPPGPPGPPGPPGSRRAKGPRQPSMFNGQCPGETCAIPN    211 - 280
DDTLVGKADEKASEHHSPQAESMITSIGNPVQVLKVTETFGTWIRESANKSDDRIWVTEHFSGIMVKEFK    281 - 350
DQPSLLNGSYTFIHLPYYFHGCGHVVYNNSLYYHKGGSNTLVRFEFGQETSQTLKLENALYFDRKYLFAN    351 - 420
SKTYFNLAVDEKGLWIIYASSVDGSSILVAQLDERTFSVVQHVNTTYPKSKAGNAFIARGILYVTDTKDM    421 - 490
RVTFAFDLLGGKQINANFDLRTSQSVLAMLAYNMRDQHLYSWEDGHLMLYPVQFLSTTLNQ             491 - 551
//

Text Mined References (9)

PMID Year Title
24049095 2013 Genome-wide association study of sex hormones, gonadotropins and sex hormone-binding protein in Chinese men.
22462667 2012 Nodal proteins are target antigens in Guillain-Barré syndrome.
22009740 2011 Fibronectin type III-like domains of neurofascin-186 protein mediate gliomedin binding and its clustering at the developing nodes of Ranvier.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16039564 2005 Gliomedin mediates Schwann cell-axon interaction and the molecular assembly of the nodes of Ranvier.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12642876 2003 Identification and characterization of CRG-L2, a new marker for liver tumor development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.