Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MKHLVASSILGVFVLTPSLAMMNIRFNHPLYGSFGTQIIHIGAFQGMVSIRDNNIFSEWDGILDYKNALL      1 - 70
VAKVFNKMACVLARMDKAVFPSLDDISKALDKQAFKYYPSTRGLTYTVLPSWVKNLAQYGKPIKNMCRDD     71 - 140
PTYFAQQQKEGTALAIDSNSCFEIQLLSFMGLFICGETPGL                                 141 - 181
//

Text Mined References (4)

PMID Year Title