Property Summary

NCBI Gene PubMed Count 78
PubMed Score 169.16
PubTator Score 114.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.100 1.2e-03
osteosarcoma -1.142 4.4e-02
non-small cell lung cancer -1.483 2.3e-20
intraductal papillary-mucinous adenoma (... -1.200 4.8e-05
intraductal papillary-mucinous carcinoma... -1.100 8.4e-05
intraductal papillary-mucinous neoplasm ... -1.200 1.4e-03
lung cancer -1.200 4.8e-03
interstitial cystitis 1.300 2.4e-05
lung adenocarcinoma -1.032 2.8e-11
invasive ductal carcinoma -1.200 1.0e-02

Gene RIF (63)

PMID Text
26656196 Our findings suggest that the Cx37 C1019T variation may contribute to the risk of PCOS in the South Indian women.
26588185 The protective effect of the T allele of the Cx37 gene might be strongly modified by smoking; in women, this effect could be mediated through stem cells.
24937033 Review/Meta-analysis: Cx37 C1019T was a risk factor for myocardial infarction and a protective factor for coronary artery disease.
24773516 three variants in PNPLA3 gene may be a genetic risk factor for NASH
24685073 The C allele in the CX37 gene might be associated with the susceptibility to EH in population of Wuxi, China.
24333099 the C1019T polymorphism may be a moderate risk factor for MI and that DM was likely a potential source of between-study heterogeneity. [META-ANALYSIS]
24261225 Determination of Cx37 C1019T and eNOS G894T polymorphisms may be used to detect a genetic predisposition to the development of myocardial infarction in patients with hemodynamically insignificant atherosclerosis and in apparently healthy individuals.
23926016 1019C/T polymorphism in the CX37 gene is associated with susceptibility to coronary artery disease as well as restenosis after coronary stenting in male patients.
23724624 It is suggested that the polymorphism in the Cx37 gene (but not Cx40 gene) potentially plays a significant role in the manifestation of AMI disease in Iranian population
22901223 C1019T polymorphism in the connexin 37 gene is associated with Helicobacter pylori infection and gastric cancer.
22729648 The data show that induced expression of either Cx37 or Cx40 in Cx43-expressing cells can selectively alter the intercellular exchange of some molecules without affecting the transfer of others.
22528526 We report the presence of connexins in platelets, notably connexin37, and that the formation of gap junctions within platelet thrombi is required for the control of clot retraction.
22305353 GJA4 polymorphism is not associated with stroke risk in the Taiwanese population.
21810657 We propose that the establishment of gap junctional communication between Cx37-expressing platelets provides a mechanism to limit thrombus propensity.
21617605 In women with higher fasting glycemia TT genotype of Cx37 polymorphism was protective against subclinical atherosclerosis.
21208019 The gene for Cx37 was associated with subclinical atherosclerosis in women with type 1 and 2 diabetes and in women with advanced central obesity.
21172909 Endothelium-dependent vasodilation is primarily mediated by connexin 37 in mesenteric artery.
21044781 Connexin 37 genetic variants significantly affect carotid IMT and contribute to future development of ischemic stroke
21044781 Observational study of gene-disease association. (HuGE Navigator)
20959880 Observational study of gene-disease association. (HuGE Navigator)
20705954 Cx37 C1019T polymorphism is associated with tumour cell proliferation.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20530971 Results show that Cx40, Cx37, Cx43 and Cx45 were expressed within the glomeruli.
20452482 Observational study of gene-disease association. (HuGE Navigator)
20142115 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20081116 Data show for the first time a functional and specific interaction between eNOS and Cx37 in endothelial cells.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19478091 The alpha helical structure of the connexin 37 N terminus may be dispensable for protein localization, but it is required for channel and hemichannel function.
19420105 Observational study of gene-disease association. (HuGE Navigator)
19407064 connexin37 C1019T polymorphism is associated with peripheral artery disease in Japanese type 2 diabetic patients.
19282863 Observational study of gene-disease association. (HuGE Navigator)
19166859 The electrical properties of Cx37 hemichannels (HCs) and gap junction channels (GJCs) were measured with voltage-clamp methods.
19056482 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18724972 Observational study of gene-disease association. (HuGE Navigator)
18664489 As much as half the length of the connexin N-terminus can be deleted without affecting formation of gap junction plaques, but an intact N-terminus is required for hemichannel gating and intercellular communication.
18605953 variation in the connexin gene may modify effects risk factors have on vascular function
18605953 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18073482 Study suggests that GJA4 gene C1019T polymorphism and/or its related C-C-D haplotype might contribute to an increased risk of CAD and potentially play an important role in the development of coronary atherosclerosis in northern Han Chinese.
18073482 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
17922338 This study investigates the responses of endothelial connexin 37, connexin 40, and connexin 43 (Cx37, Cx40, and Cx43) to shear stress and substrate.
17785925 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17719307 Observational study of gene-disease association. (HuGE Navigator)
17531234 Connexin 37 is expressed in the granulosa layer of follicles in the human ovary, and expression of Cx37 in granulosa cells was not different between poor responder and nonpoor responder to ovulation induction.
17418016 Observational study of gene-disease association. (HuGE Navigator)
17318613 Cx37 is expressed in the vascular endothelium as well as in monocytes and macrophages and these three cell types are key players in atherogenesis.
17196598 Observational study of gene-disease association. (HuGE Navigator)
17196598 The connexin37 C1019T polymorphism is not related with markers of subclinical atherosclerosis in young adults in Finland
16998253 Observational study of gene-disease association. (HuGE Navigator)
16677656 Observational study of gene-disease association. (HuGE Navigator)
16677656 investigated whether the allelic variants 1019C and 1019T are differentially predictive of increased risk for coronary artery disease (CAD) and myocardial infarction (MI)
16361362 This is the first study to demonstrate that flow simultaneously and differentially regulates expression of the Cx37, Cx40, and Cx43 proteins.
15982495 Observational study of gene-disease association. (HuGE Navigator)
15982495 T1019 Cx37 SNP has shown to be a risk factor for acute myocardial infarction (AMI).
15504903 Here, data for human connexin37 (hCx37) hemichannels indicate that voltage gating can be explained as block/unblock without the necessity for an independent voltage gate.
15481066 NO inhibits the intercellular transfer of small molecules by a specific influence on Cx37
15234427 Observational study of genotype prevalence. (HuGE Navigator)
15194487 These data suggest that alterations of specific connexins, in this case connexin 37, and resulting changes in intercellular communication may modulate endothelial cell growth and death.
15167446 Observational study of gene-disease association. (HuGE Navigator)
14667880 mRNA levels of connexins in different sizes of luteinized normal and hyperstimulated follicles.
12477941 Observational study of gene-disease association. (HuGE Navigator)
11744143 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAF      1 - 70
PISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVA     71 - 140
EDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFI    141 - 210
IFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPT    211 - 280
YNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV                     281 - 333
//

Text Mined References (79)

PMID Year Title
26656196 2016 Analysis of Connexin37 gene C1019T polymorphism and PCOS susceptibility in South Indian population: case-control study.
26588185 2016 Smoking impairs and circulating stem cells favour the protective effect of the T allele of the connexin37 gene in ischemic heart disease--A multinational study.
24937033 2014 Association of Connexin37 C1019T with myocardial infarction and coronary artery disease: a meta-analysis.
24773516 2014 Cx37 C1019T polymorphism may contribute to the pathogenesis of coronary heart disease.
24685073 2014 Association between 1019C/T polymorphism in the connexin 37 gene and essential hypertension.
24333099 2014 The Connexin37 gene C1019T polymorphism and risk of coronary artery disease: a meta-analysis.
24261225 2013 [Endothelial NO synthase and connexin 37 gene polymorphisms as a risk factor for myocardial infarction in subjects without a history of coronary artery disease].
23926016 2013 [Association between 1019C/T polymorphism of Connexin 37 gene and restenosis after coronary stenting].
23840749 2013 MOR is not enough: identification of novel mu-opioid receptor interacting proteins using traditional and modified membrane yeast two-hybrid screens.
23724624 2013 Mutations of the connexin 37 and 40 gap-junction genes in patients with acute myocardial infarction.
22901223 2012 Association between C1019T polymorphism in the connexin 37 gene and Helicobacter pylori infection in patients with gastric cancer.
22729648 2012 Inducible coexpression of connexin37 or connexin40 with connexin43 selectively affects intercellular molecular transfer.
22648509 2012 PKNOX2 is associated with formal thought disorder in schizophrenia: a meta-analysis of two genome-wide association studies.
22528526 2012 Gap junctions and connexin hemichannels underpin hemostasis and thrombosis.
22305353 2012 Lack of association between a functional genetic variant of connexin 37 and ischemic stroke in a Taiwanese population.
21810657 2011 Connexin 37 limits thrombus propensity by downregulating platelet reactivity.
21617605 2011 The association between subclinical atherosclerosis in carotid arteries and Connexin 37 gene polymorphism (1019C>T; Pro319Ser) in women.
21208019 2010 The connexin 37 (1019C>T) gene polymorphism is associated with subclinical atherosclerosis in women with type 1 and 2 diabetes and in women with central obesity.
21172909 2011 Endothelium-dependent vasodilation in human mesenteric artery is primarily mediated by myoendothelial gap junctions intermediate conductance calcium-activated K+ channel and nitric oxide.
21044781 2011 Genetic variants of connexin37 are associated with carotid intima-medial thickness and future onset of ischemic stroke.
20959880 2010 Lack of an association between connexin-37, stromelysin-1, plasminogen activator-inhibitor type 1 and lymphotoxin-alpha genes and acute coronary syndrome in Czech Caucasians.
20705954 2010 Unexpected role for the human Cx37 C1019T polymorphism in tumour cell proliferation.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20530971 2010 High-level connexin expression in the human juxtaglomerular apparatus.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20142115 2010 Influence of polymorphisms in candidate genes on early vascular alterations in obese children.
20081116 2010 Gap junction protein Cx37 interacts with endothelial nitric oxide synthase in endothelial cells.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19478091 2009 The N terminus of connexin37 contains an alpha-helix that is required for channel function.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19407064 2009 Association between the connexin37 polymorphism and peripheral arterial disease in subjects with type 2 diabetes.
19282863 2009 Association of candidate gene polymorphisms with chronic kidney disease in Japanese individuals with hypertension.
19166859 2009 Functional differences between human Cx37 polymorphic hemichannels.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18724972 2008 Sex differences in environmental and genetic factors for hypertension.
18664489 2008 An intact connexin N-terminus is required for function but not gap junction formation.
18605953 2008 The influence of smoking and homocysteine on subclinical atherosclerosis is modified by the connexin37 C1019T polymorphism - The Cardiovascular Risk in Young Finns Study.
18073482 2008 Association of connexin 37 gene polymorphisms with risk of coronary artery disease in northern Han Chinese.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17922338 Endothelial connexin 37, connexin 40, and connexin 43 respond uniquely to substrate and shear stress.
17785925 2007 Common single nucleotide polymorphisms in Japanese patients with essential hypertension: aldehyde dehydrogenase 2 gene as a risk factor independent of alcohol consumption.
17719307 2007 Connexin37 (GJA4) genotype predicts survival after an acute coronary syndrome.
17531234 2008 Expression and comparison of gap junction protein connexin 37 in granulosa cells aspirates from follicles of poor responder and nonpoor responder patients.
17418016 2007 [Association of C1019T polymorphism in the connexin 37 gene and coronary artery disease in Chinese Han population].
17318613 2007 Connexin37: a potential modifier gene of inflammatory disease.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17196598 2007 Associations between connexin37 gene polymorphism and markers of subclinical atherosclerosis: the Cardiovascular Risk in Young Finns study.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
16998253 2006 Identification of genetic factors and development of genetic risk diagnosis systems for cardiovascular diseases and stroke.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16677656 2007 Do allelic variants of the connexin37 1019 gene polymorphism differentially predict for coronary artery disease and myocardial infarction?
16361362 2006 Flow regulates intercellular communication in HAEC by assembling functional Cx40 and Cx37 gap junctional channels.
15982495 2005 Association between C1019T polymorphism of connexin37 and acute myocardial infarction: a study in patients from Sicily.
15504903 2004 Polyvalent cations constitute the voltage gating particle in human connexin37 hemichannels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15481066 2005 Nitric oxide specifically reduces the permeability of Cx37-containing gap junctions to small molecules.
15234427 2004 Genotypes associated with myocardial infarction risk are more common in African Americans than in European Americans.
15194487 2004 Adenoviral delivery of human connexin37 induces endothelial cell death through apoptosis.
15167446 2004 Genetic analysis of 22 candidate genes for hypertension in the Japanese population.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667880 2003 Significance of mRNA levels of connexin37, connexin43, and connexin45 in luteinized granulosa cells of controlled hyperstimulated follicles.
12477941 2002 Prediction of the risk of myocardial infarction from polymorphisms in candidate genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11744143 2001 Connexin37 gene polymorphism and coronary artery disease in Taiwan.
11375929 2001 Diverse transcriptional initiation revealed by fine, large-scale mapping of mRNA start sites.
10728596 2000 Human hemangiosarcomas have a common polymorphism but no mutations in the connexin37 gene.
10447790 1999 A genetic polymorphism in connexin 37 as a prognostic marker for atherosclerotic plaque development.
9843209 1998 Mutations in the human connexin gene GJB3 cause erythrokeratodermia variabilis.
9617570 1998 Tumour necrosis factor alpha alters the expression of connexin43, connexin40, and connexin37 in human umbilical vein endothelial cells.
9546360 1998 Connexin43 gap junctions in normal, regenerating, and cultured mouse bone marrow and in human leukemias: their possible involvement in blood formation.
9020357 1997 Female infertility in mice lacking connexin 37.
8761439 1996 Human connexin 37 is polymorphic but not mutated in tumours.
8586454 1995 The gene for human gap junction protein connexin37 (GJA4) maps to chromosome 1p35.1, in the vicinity of D1S195.
7680674 1993 Molecular cloning and functional expression of human connexin37, an endothelial cell gap junction protein.
2167375 1990 Connexin family of gap junction proteins.
1964417 1990 Six genes of the human connexin gene family coding for gap junctional proteins are assigned to four different human chromosomes.
1688855 1990 Modulation of gap junction transcript and protein expression during pregnancy in the rat.
1370487 1992 Four novel members of the connexin family of gap junction proteins. Molecular cloning, expression, and chromosome mapping.