Property Summary

NCBI Gene PubMed Count 448
PubMed Score 3888.36
PubTator Score 1729.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Heart disease 279 5.601 2.8
Disease Target Count Z-score Confidence
Palmoplantar keratosis 36 3.648 1.8
Cataract 104 0.0 4.0
Hypotrichosis 29 0.0 4.0

Expression

  Differential Expression (30)

Disease log2 FC p
malignant mesothelioma -3.000 1.3e-07
osteosarcoma 2.269 4.0e-03
group 4 medulloblastoma -3.600 4.5e-07
medulloblastoma, large-cell -4.400 7.9e-06
primitive neuroectodermal tumor -2.100 1.4e-02
Duchenne muscular dystrophy 2.378 2.4e-08
autosomal dominant Emery-Dreifuss muscul... 2.328 8.3e-04
Becker muscular dystrophy 1.403 1.2e-02
juvenile dermatomyositis 1.858 2.2e-10
acute quadriplegic myopathy 1.242 2.2e-02
primary pancreatic ductal adenocarcinoma 2.269 7.1e-03
intraductal papillary-mucinous adenoma (... -3.000 2.1e-03
intraductal papillary-mucinous carcinoma... -2.700 2.2e-02
intraductal papillary-mucinous neoplasm ... -2.400 4.0e-02
lung cancer -1.300 5.8e-04
active ulcerative colitis 5.128 3.8e-03
breast carcinoma 1.800 1.0e-02
diabetes mellitus -1.400 3.0e-02
lung adenocarcinoma -1.700 7.2e-06
aldosterone-producing adenoma -1.082 5.0e-02
nasopharyngeal carcinoma 1.400 8.0e-03
lung carcinoma -1.300 2.2e-08
gastric carcinoma 2.300 1.3e-02
invasive ductal carcinoma -1.200 4.4e-02
ovarian cancer -4.600 4.6e-07
Breast cancer -1.500 9.9e-04
pituitary cancer -3.700 3.9e-07
Down syndrome 1.600 5.1e-03
pancreatic cancer 2.200 4.3e-03
dermatomyositis 2.300 2.2e-03

Protein-protein Interaction (4)

Gene RIF (391)

PMID Text
26902399 high glucose disassociated interactions between Cx43 and tight junctions, and then increased airway epithelial transepithelial electrical resistance and permeability by down-regulation of Cx43 in human airway epithelial cells.
26869446 Increased membrane permeability induced by linoleic acid is mediated by an intracellular signaling pathway activated by GPR40 that leads to an increase in membrane levels of Cx43 phosphorylated at serine 373 via Akt.
26823747 Report expression of connexin 43 in ovarian cancer cells in G1/S phase.
26784020 Connexin 43 significantly regulates osteogenic differentiation in the cells from posterior longitudinal ligament by altering the activity of ERK, and subsequently causing the modification of Runx2.
26586821 The results of this study showed that in the olfactory bulb, connexin 43 hemichannel function is promoted by neuronal activity and modulates neuronal network slow oscillations.
26543049 Stage of labour effected uterine expression of phosphorylated form
26517241 Cx43 expressed by mesenchymal stem cells induces apoptosis on leukemia cells.
26491675 AR pathway plays an important role in regulation of CX43 expression in prostate cancer cells. AR may be the upstream signal of CX43.
26481195 Cx43-Hsc70 interaction regulates cell cycle G1/S progression through a novel mechanism by which Cx43-Hsc70 interaction prevents the nuclear accumulation of p27 through controlling the nuclear translocation of cyclin D1-CDK4-p27 complex.
26450928 we are the first to identify that miR-381 suppresses C/EBPalpha-dependent Cx43 expression in breast cancer cells. The miR-381-C/EBPalpha-Cx43 axis might be a useful diagnostic and therapeutic target of metastatic breast cancer
26446715 Data show that both connexin 43 (Cx43) expression and gap junctional intercellular communication (GJIC) function were increased by All-trans retinoic acid (ATRA) treatment.
26445057 The data indicate for the first time that increased cytoplasmic human papillomavirus type 16 E6 levels associated with malignant progression alter Cx43 trafficking and recycling to the membrane and the E6/human Dlg interaction may be involved.
26442583 findings demonstrate that dissociation of the GAPDH/Siah1 pro-apoptotic complex can block high glucose-induced pericyte apoptosis, widely considered a hallmark feature of DR
26398895 data demonstrated that Cx43 controls proliferation and the formation of IH after arterial engraftment
26376117 Cx43 increases calcium-induced DSPP expression and odontoblastic differentiation of dental pulp stem cells via Erk1/2 through gap junction-mediated cell-to-cell contacts.
26349540 Data show that connexin43 (Cx43) levels are differentially regulated in fibroblasts from ODDD patients
26335100 Our data suggest a mechanism by which CT-Cx43 may regulate cell proliferation by regulating mir-125b and p53 expression
26334722 Cx43, which is up-regulated by mechanical stress, seems to function partly via the activation of ERK1/2 and p38 MAPK signals to promote the osteoblastic differentiation of ligament fibroblasts.
26324251 local regulation of endothelial Cx43 expression within the vasculature regulates monocyteendothelial adhesion.
26318481 Cx43 may be negatively regulated the development, invasion and metastasis of gastric cancers, however, it had no obvious relationship with tumor cell apoptosis.
26299454 ER-alpha status of endometrioid adenocarcinomas could restrict eventual proapoptotic or anti-apoptotic impact of aberrantly expressed Cx43 and Cx26 in these tumors.
26283635 miR-200a directly inhibits Cx43 expression via a canonic-binding element.
26255026 a novel mechanism by which Cx43 can modify actin cytoskeletal dynamics and may thereby enhance cell migration.
26251520 High connexin 43 expression is associated with poor prognosis in non-muscle invasive urothelial bladder cancer.
26221040 first evidence that the hypoxic microenvironment negatively affects the immune surveillance of tumors by NK cells through the modulation of Cx43-mediated intercellular communications
26202915 TGF-beta1 up-regulates Cx43 and increases gap junction intercellular communication activities (GJIC) in human granulosa cells
26191122 the Cx43 expression level is inversely correlated with the tumor grade and proliferation and migration activity of human glioma tumors
26189259 Microarray data of the expression level of key genes reveals that GJA1 is critical for cervical cancer invasion and metastasis.
26186970 An important role for Cx43 in mediating the effects of TGF-beta on human ovarian cancer cell migration.
26135897 findings reveal an important role for Cx43 in intrinsically controlling melanoma growth, death and metastasis
26046157 Mutations in GJB2, GJB6 and GJA1 are not a major cause of non-syndromic deafness in black Africans
26031779 an important role for Connexin43 as a negative regulator of EGF-induced human ovarian cancer cell proliferation
26025955 demonstrate a specific role of the upstream DNA methylation/miR-1298/Connexin 43 pathway in regulating VSMC function
26018820 Taken together, in Jar cells, placental connexins 43 and 46 are regulated during periods of low oxygen in opposite manners
26011388 Spermine enhances connexin 43-mediated gap junctional communication and may preserve neuronal excitability during ischemia and trauma when pH in the brain acidifies.
26009201 We present the current knowledge of protein kinase C (PKC)-dependent regulation of Cx43 and discuss the divergent results.
26009200 cardiac fibroblasts have been demonstrated to increase Cx43 expression in experimental models of myocardial infarction and functional gap junctions between myocytes and fibroblasts have been reported.
26009199 Current evidence shows that Cx43 plays a crucial role in organizing microtubules at the intercalated disc and thereby regulating the trafficking of the cardiac sodium channel NaV1.5 to the membrane
26009195 It is clear that both CMPs and antisense oligonucleotides hold therapeutic potential, however maintaining Cx43 expression may be beneficial to the cell by preserving other non-channel functions of Cx43
26009194 Degradation of Cx43, the major ventricular GJ protein, has been associated to up-regulation of autophagy at the onset of heart ischemia and ischemia/reperfusion (I/R), which can have profound implications upon cardiac function.
26009193 Cx43 is the most widely expressed and studied Cx and constitutes the main topic of this review
26002762 functional Cx43 is required for mural cell-induced endothelial quiescence
25976645 A novel truncation mutation in GJA1 is associated with OAG (open-angle glaucoma) and microcornea in a Chinese family.
25960544 Suggest a role for connexin43 in prostate cancer invasion and metastasis.
25959821 Glioblastoma cancer stem cells (CSCs) express Cx46, while Cx43 is predominantly expressed in non-CSCs. During differentiation, Cx46 is reduced, while Cx43 is increased, and targeting Cx46 compromises CSC maintenance
25952184 Phosphorylation of Cx43 during odor or inhibitor stimulation may be mediated by ERK and JNK signaling pathway. The data suggest that expression of Cx43 can regulate the odor response.
25933380 Downregulation of Cx43 expression and gap junction coupling in neoplastic stromal cells are associated with the clinical progression and worse prognosis in giant cell tumor of bone.
25926558 Suggest connexin 43 has role in determining migration patterns of glioma cells.
25903580 The identification of Cx43 interactors will provide clues to the functions of Cx43 in human cells and its roles in the development of several diseases, including osteoarthritis.
25901741 GATA-3 augmentation down-regulates Connexin43 in Helicobacter pylori associated gastric carcinogenesis
25873300 Beta2-adrenergic receptor signaling has growth inhibitory effects via modulation of the cAMP/PKA pathway in A-1321N1 cells through increasing the expression level of Cx43 and miR-146a as well as decreasing miR-155 and miR-27a levels.
25843295 Cx43 downregulation (a constitutive feature of G2/M phase) selectively renders tumour cells hypersensitive to low-dose radiation, and presents connexins as potential therapeutic targets.
25815348 Cx43 channels are critical in FDC and "ex vivo" germinal center development and in the persistence of FDC in follicular lymphomas but do not affect tumor progression.
25760687 A Cx43 mimetic peptide targeting the microtubule-binding domain of Cx43 was used to study ATP released through Cx43 hemichannels into the vasculature, which is an important signal driving the early inflammatory response to implanted devices.
25625422 The functional paradox produced by oligomerization of Cx43 and Cx26 Keratitis-Ichthyosis-Deafness syndrome mutants could underlie the severe syndromic phenotype in human skin.
25584940 suppressed function of Cx43 in fibroblasts promotes their migration, and regulates expression of wound healing-associated genes via AP1, SP1, MAPK, GSK3alpha/beta and TGF-beta signaling pathways, and may promote fast and scarless wound healing in human gingiva.
25583071 Cx43-interacting protein plays a role in regulating the levels of connexins through proteasomal degradation.
25560303 These results provide evidence that Cx43 and gap junction activity are up-regulated by TGF-beta1 in human trophoblast cells, which subsequently contributes to TGF-beta1-induced trophoblast differentiation.
25504652 The strong cardiac phenotype of Cx43E42K expressing mice supports the association between the human Cx43E42K mutation and SIDS and indicates that Connexin43 mutations should be considered in future studies when SIDS cases are to be molecularly explained.
25496568 Increasing or decreasing CX43 expression alters inflammatory genes expressed by synovial cells.
25401181 Connexin45 has much more rapid gating kinetics than connexin43
25398053 Cx43 has a role in epidermal homeostasis, and in erythrokeratodermia variabilis et progressiva, without features of oculodentodigital dysplasia
25386667 N-cadherin and connexin 43 expression in in group of diffuse astrocytomas and anaplastic astrocytomas may be evidence for their role in tumor formation and progression
25383624 Results show high mRNA and protein levels for Cx43 and Cx30 in breast cancer but they are correlated with improved and bad outcome respectively suggesting that they may serve as prognostic markers in breast cancer.
25270527 This study reveals for the first time that Cx43 and Cx32 are down-regulated in keratocystic odontogenic tumours
25239217 Data suggest that expression of connexin 43 (GJA1) in differentiating granulosa cells is regulated by testosterone, 1,25-dihydroxyvitamin D3, and calcium signaling.
25227101 It is likely that Cx43 and Pax3 play critical roles in cell proliferation and differentiation during the processes of chorionic villi initiation/development and placental morphogenesis.
25206281 Cx32 and Cx43 mRNA expression decreased gradually during H. pylori infection-associated gastric carcinogenesis, and it is associated with hypermethylation of these genes' promoter.
25168385 Results demonstrated that a missense mutation in GJA1 is linked to keratoderma-hypotrichosis-leukonychia totalis syndrome without extracutaneous involvement.
25124494 This is a novel gene implicated in atrial fibrillation
25110696 Cx43 may play an important role in eosinophil transendothelial migration and function in sites of inflammation.
25070368 associated molecule with the SH3 domain of STAM-mediated deubiquitination of connexin 43 protects Gap junctions from degradation
24967639 increased lung vascular permeability induced by inflammatory conditions may be amplified via increased expression of Cx43 and intercellular communication among pulmonary endothelial cells.
24833468 Connexin43 siRNA promotes HUVEC proliferation and inhibits apoptosis induced by ox-LDL, and ERK signaling pathway appears to be involved in these processes.
24819345 Down-regulation of connexin43 by microRNA-130a in cardiomyocytes results in cardiac arrhythmias.
24815435 loss of Cx43 may be an important event in colon carcinogenesis and tumor progression, providing significant insights about the tumor suppressive properties of the Cx43 and its potential as a diagnostic marker for colon cancer.
24789679 Cx43 reverses CDDP resistance in A549 CDDP-resistant cells by preventing EMT, making Cx43 a possible therapeutic target for lung cancer.
24788723 Results found that the expression of Cx26 and Cx45 had no prognostic value but Cx43 was upregulated in tumour epithelia and membrane Cx43 expression was associated with short overall survival time.
24785695 Mutations in GJB6 and GJA1 are not a major cause of nonsyndromic deafness in this group of Africans from Cameroon and South Africa. there is no sufficient evidence to support their testing in a clinical setting for individuals of African ancestry.
24774648 Data revealed that Cx43 immunoreactivity levels in orbitofrontal cortex are significantly reduced in subjects with alcohol dependence, major depressive disorder or comorbid depression plus alcohol dependence relative to non-psychiatric comparison subjects
24751918 In this study. point mutations within the Cx43-gene could not be identified as a cause of the development of Tetralogy of Fallot.
24742583 Low CX43 expression is associated with pancreatic cancer.
24724781 alteration of Cx43 expression in BMSCs is involved in the interactions of MM cells with the BM environment and plays a crucial role in the adhesion and migration of MM cells.
24675463 Cx43 in Temozolomide (TMZ) resistance occurred by TMZ-resistant glioblastoma cells being able to activate epidermal growth factor receptor.
24636551 Overexpression of connexin 43 had a positive effect on skeletal myoblasts used in stem cell therapy.
24508941 this report broadens the spectrum of probably pathogenic mutations in GJA1 gene associated with oculo-dento-digital dysplasia phenotype and demonstrates that the amino acid substitutions at highly conserved positions 47, 86, 106 may affect protein functioning and lead to the development of this syndrome.
24503443 High Snail-1 and Cx43 levels accompanied high motility and nanomechanical elasticity of a prostate cancer cell line.
24500718 PKC phosphorylation causes degradation of Cx43 without dephosphorylation
24457967 Cx43 regulates c-Src activity and proliferation in human glioma stem cell
24457961 In the absence of hCx43 protein increased neuronal differentiation.
24445236 This review summarizes recent data on Cx43-controlled neurogenesis in the context of NVU development and functioning.
24434540 the links between germ-line mutations in the gene encoding Cx43 (GJA1) and the human disease termed oculodentodigital dysplasia (Review)
24413384 Oocyte-derived BMP15 decreases gap junction intercellular communication activity between human granulosa cells by down-regulating Cx43 expression, most likely via a Smad-dependent signaling pathway.
24376266 Cx43, the main gap junction protein of the immune system, accumulates at the contact zone of NK cells and DCs or at the interface between NK cells and target cells, facilitating DC-mediated NK cell activation and cytotoxic activity against tumor cells.
24368520 the combination of non-phosphorylated Cx43 and C5b-9 immunohistochemistry is useful for detecting early lesions of myocardial ischemia in sudden cardiac death.
24294380 Connexin 43 had no diagnostic value in arrhythmogenic right ventricular cardiomyopathy.
24270393 Connexin 43 is down-regulated in eutopic endometrium and cultured endometrial stromal cells from subjects with endometriosis.
24241398 The localization and distribution of gap junction (GJ) intercellular channels and connexin 43 (Cx43) in cells surrounding spiral ganglion cell bodies in man and guinea pig, were analyzed.
24213533 Akt-dependent phosphorylation of Serine 373 increases gap junction size and communication by completely eliminating the interaction between Cx43 and ZO-1.
24210816 Authors report that internal translation within Cx43 (GJA1) mRNA occurs, resulting in truncated isoforms that autoregulate Cx43 trafficking.
24146179 miR-1 and 206 is down-regulated in TOF patients, which may cause an up-regulation of Cx43 protein's synthesis.
24134157 Our studies demonstrated that HIV infection of astrocytes, despite minimal replication and a low number of infected cells, induces dysregulation of DKK1 secretion by a Cx43 hemichannel (HC)-dependent mechanism
24119489 Mutations in connexin 43 gene in patients with chronic rhinosinusitis, including recurrent acute rhinosinusitis, appear to be rare
24056538 Cx43-Hsc70 interaction probably plays a critical role during G1/S progression.
24046143 miR-125b regulates glioma growth partly through Connexin43 protein.
24040271 The abnormal expression of Cx43 plays an essential role in peritoneal metastasis of gastric neoplasms.
23991165 findings suggest that autoantibody-independent astrocytic Cx43 loss may relate to disease aggressiveness and distal oligodendrogliopathy in both MS and NMO
23978378 Human cytomegalovirus downregulates Cx43 protein and mRNA levels in normal fibroblasts.Human cytomegalovirus immediate early proteins promote degradation of connexin 43.
23951358 A novel autosomal recessive GJA1 missense mutation linked to Craniometaphyseal dysplasia.
23922689 These results demonstrate that Cx43-mediated gap junctional intercellular communication between human embryonic stem cells (hESC) and adipose-derived stem cells feeder cells is not an important factor for the conservation of hESC stemness and expansion.
23828237 phosphorylation may also indirectly regulate binding affinity by altering the conformational preference of the Cx43CT domain
23819010 17-beta-estradiol modulates connexins and integrins as well as ER-beta expression induced by high frequency electromagnetic fields.
23800357 Cx43 expression can delay early hepatocellular carcinoma recurrence, metastasis, and poor prognosis after radical hepatectomy in patients with hepatitis B virus-related hepatocellular carcinoma and low AFP.
23768164 The inhibitory effects of TNF-alpha on Cx43 expression in human corneal fibroblasts are mediated, at least in part, by the JNK signaling pathway, which therefore likely plays a role in corneal inflammation.
23750535 Results suggest that Cx43 may be used as a biomarker to select and isolate the remnant neural crest (NC) pluripotent stem cells from adult tissues arising from this embryological structure.
23706332 The spatial organization of claudin-11 and connexin-43 is altered in men with primary seminiferous tubule failure.
23679094 VAX1 rs10787760, rs6585429 and rs1871345 polymorphisms may be involved in nonsyndromic cleft lip with or without cleft palate in Brazilian patients, but there is no association with polymorphisms in FGF12, VCL, or CX43
23678036 Data from cultured myometrial cells from pregnant women undergoing elective cesarean section suggest that PGF2alpha dose dependently increases CX43 and PTGS2 (cyclooxygenase 2) and decreases PTGFR (PGF2alpha receptor) in upper/lower uterus.
23621211 Cx43 and E-cadherin are reduced with non-small cell lung cancer progression, and might be important biomarkers for judging the metastasis and prognosis.
23606748 Autosomal recessive GJA1 (Cx43) gene mutations cause oculodentodigital dysplasia by distinct mechanisms.
23586710 The results indicate that CIP85 increases Cx43 turnover by accelerating the internalization of Cx43 from the plasma membrane.
23579271 Cx43 and Cx40 but not Cx37 promote apoptosis via gap junctional transfer of pro-apoptotic signals between cells.
23568744 abnormal expression of Cx43 protein is involved in oral mucosa carcinogenesis.
23544880 Most of the Pelizaeus-Merzbacher-like disease (PMLD)-linked Cx47 mutants disrupt Cx47/Cx47 and Cx47/Cx43 gap junction function in the glial network, which may play a role in leading to PMLD disease symptoms
23420013 CX43 expression is important for reprogramming and may mediate the MET that is associated with the acquisition of pluripotency.
23386650 Theca cell-derived BMP4 and BMP7 down-regulate Cx43 expression and decrease gap junction cell communication activity in human granulosa cells.
23376080 Asp378 and Asp379 in the C-terminal part of Cx43 are essential for loop/tail interactions in Cx43 hemichannels, while Pro375 and Pro377 may help to properly coordinate the critical Asp residues.
23363606 results demonstrate that phosphorylation on Ser-279 and Ser-282 not only disrupts gap junction assembly by triggering endocytosis of Cx43 prior to its assembly but also likely regulates plaque growth
23354732 Reduction of connexin43 in human endothelial progenitor cells impairs the angiogenic potential.
23344009 The significantly higher Cx43 staining in malignant melanoma when compared with nevi suggests an oncogenic role for this protein in melanocytic tumor progression
23328809 Cx43 and HC1 are likely to play the pivotal roles in the mediation of the astrocytic death.
23322705 The regulation of runt-related transcription factor 2 by fibroblast growth factor-2 and connexin43 requires the inositol polyphosphate/protein kinase Cdelta cascade.
23257890 The expression of gap-junction Cx43 in bladder smooth muscle cells decreases under sustained hydrostatic pressures above the physiological level in the longer term.
23255671 Hypoxia and ischemia per se downregulate Cx43 protein expression in atrial cardiomyocytes.
23178689 A reduced immunoreactive signal of PKG, Cx43, and NaV1.5 at the intercalated disks can be observed in a large majority of the patients.
23151788 findings suggest that ZO-1 and alpha-catenin are important for gap junctions containing Cx43 in the LECs
23095853 Under pathological conditions, when intracellular calcium is elevated, Cx43 hemichannel opening is promoted in cardiomyocytes.
23042455 Resulting in the dephosphorylation of Cx43.
22951570 Study provided a research method for connexin 43 (Cx43) gene and a selection platform for the drugs targeting the Cx43 gene.
22918484 Connexin 43 as a potential cancer diagnostic and prognostic marker, as well as a promising therapeutic target for testicular diseases.
22809623 oculodentodigital dysplasia-linked Cx43 N-terminal mutants formed nonfunctional gap junction-like plaques and exhibited dominant-negative effects on coupling conductance of coexpressed endogenous Cx43; studies suggest the nature of the mutation conveys loss of Cx43 function by distinctly different mechanisms rooted in the structure of the N-terminal region
22785209 miR-20a significantly contributes to the progression of prostate cancer by targeting CX43.
22775996 During wound healing, mutant Cx43 may enhance keratinocyte proliferation and promote early differentiation of keratinocytes.
22736223 data indicate that Cx43 regulates the growth and apoptosis of pancreatic cancer cells; Cx43 interacts with Bax to initiate the mitochondrial apoptotic pathway
22729648 The data show that induced expression of either Cx37 or Cx40 in Cx43-expressing cells can selectively alter the intercellular exchange of some molecules without affecting the transfer of others.
22657348 Dlg is a physiologically relevant regulator of Cx43 in transformed epithelial cells.
22615994 Cx43 and N-cadherin are potential therapeutic targets in the promotion of healing of venous leg ulcers, by acting at least in part through distinct contributions of cell adhesion, migration, proliferation and cytoskeletal dynamics.
22590817 The Cx alteration is moderately consistent in cervical dysplasia, and for Cx43 can precede histologic changes.
22558917 propose a pathway for understanding the microtubule-dependent regulation of Cx43 gap junctional communications
22455314 The increased levels of Cx43 from high glucose resulted in repressed filopodial extensions and significantly slower migration rates than in either standard conditions or the osmotic control of mannitol.
22446325 These studies suggest that local regulation of monocyte Cx43 activity within the vasculature can dynamically modulate the monocyte-endothelial adhesion that is an initiating event in vascular inflammatory pathologies, with the baseline adhesion set by Cx43 expression levels.
22430144 These results showed the important roles of the Cx43 C-terminus in gap junction expression and its turnover.
22422398 Cx43 gap junctions are gated and closed by a Ca2+/calmodulin-dependent mechanism involving the carboxyl-terminal quarter of the connexin CL domain.
22417726 TNF-alpha, TNFRII and Cx43 are downstream effectors of the AGEs-RAGE interaction in human microglial cell culture.
22405962 Severely hypoplastic left hearts and borderline left ventricle hearts showed reduced connexin 43 expression in interacalated disks.
22399755 A significant reduction is found in ATP release after weight-drop injury in mice with deletion of connexin43 (Cx43) compared with Cx43-expressing littermates.
22389404 During wounding, CASK is mobilized to the plasma membrane where it colocalizes with Cx43 and CADM1 1 hour after skin explant wounding.
22259903 four patients with anomalous left coronary artery from the pulmonary artery (ALCAPA) did not exhibit any evidence of association between connexin 43alpha1 and the clinical phenotype
22238282 Cx43-mediated GJIC and SLC1A5 interaction play important functional roles in trophoblast cell fusion.
22230328 Cx43 is dispensable for cellular BP binding, its uptake, as well as the proliferative effects of these agents
22180603 Cx43 emerges as a molecule that is involved not only in forming gap junctions for the cell-cell transfer of electrical charge but also as an organization centre for the establishment of proper sodium channel function.
22179534 This study provides the first molecular and functional evidence implicating a GJA1 mutation as a novel pathogenic substrate for sudden infant death syndrome.
22155212 Channel-independent influence of connexin 43 on cell migration [review]
22141269 Gossypol reduces the expression of CX43 in TM4 Sertoli cells.
22131169 Our results suggest that glioma stem cells require the low expression of Cx43 for maintaining their malignant phenotype.
22112812 Cx43-induced gap junctional changes do not initiate granulosa cell apoptosis but likely result from apoptosis induced by GnRH-I or -II.
22080401 increased expression of Cx43 in PC-3 cells led to an unfunctional, cytoplasmic localization of the protein and was correlated with a reduction of proliferation, adhesion and invasion of the cells
22049024 we report on the role of the C-terminus of connexin43 in the process of gap junction assembly
22033928 Cx43 has a dual function exporting NAD(+) and importing cADPR into the cell to activate intracellular calcium mobilization.
22012769 granulosa cell-tumor cells are characterized by a partial or complete loss of Cx43 expression and expression of Cx32
21872657 this study identifies a new mechanism of gap junction intercellular communication regulation in which endogenous g-protein coupled receptor agonists dynamically alter interactions between connexin43 and zonula occludens-1
21866551 Cx43 was found to colocalize with beta-catenin and negatively regulate the Wnt signaling pathway, and expression of Cx43 was associated with increased levels of apoptosis; data indicate that Cx43 is a colorectal cancer tumor suppressor protein that predicts clinical outcome
21858092 Data show that EMD significantly increased the expression of connexin 43 and N-cadherin at early time points ranging from 2 to 5 days.
21856279 connexin43 carboxyl terminus has a role in cardiac gap junction organization
21839722 review of functional consequences of abnormal Cx43 expression in the heart [review]
21819962 review of connexin43 phosphorylation in brain, cardiac, endothelial and epithelial tissues [review]
21763271 Connexin43 phosphorylation and cytoprotection in the heart [review]
21727092 increased activation of associated PAK1 can contribute to enhanced Cx43 dephosphorylation and impaired intercellular coupling that may underlie slow conduction in heart failure
21726529 this study provides novel insights into the regulation of gap junction function by CYPOR and suggests that Cx43 may play an important role(s) in CYPOR-mediated bone defects seen in patients.
21718795 These data suggest that Cx43 inhibits the invasion and metastasis of pulmonary giant cell carcinoma cells by modulating the secretion of FSTL1, which is regulated by histone acetylation.
21716323 Cx43 has an important role in hair regeneration, growth, and cuticle formation.
21670345 Optic nerve and retinal dysplasia was observed in both patients, and ciliary body cysts were observed in 1 patient. Both patients carried isolated in-frame deletion and missense mutations of the GJA1 gene on chromosome 6.
21669459 Cx43 reduced expression in both maternal uterine decidua and fetal chorionic villi samples of REPL patients could contribute to recurrent early pregnancy loss.
21665377 Alendronate may enhance the proliferation of osteoblastic cell line through connexin 43 activation.
21642545 A possible mechanism of Cx43 transgene activity is proposed in a newly discovered signaling pathway that regulates Foxp3 expression in regulatory T (Treg) lineage cells.
21606502 Cx43 and Cx46 have novel functions in regulating each other's expression and turnover in a reciprocal manner in addition to their conventional roles as gap junction proteins in lens cells.
21538160 The Tbx3, SOX4, and SOX2 ChIP data, identify a region in intron 1 of Connexin 43 bound by all tree proteins and subsequent ChIP experiments verify that this sequence is bound, in vivo, in the developing heart.
21532342 Enhanced PKCepsilon mediated phosphorylation of connexin43 at serine 368 by a carboxyl-terminal mimetic peptide is dependent on injury.
21442291 we propose that the increase in Cx43 expression induced by mechanical strain in ossification of the posterior longitudinal ligament cells plays an important role in the progression of Ossification of the posterior longitudinal ligament.
21424225 Study shows that fusion of a V5/6-His tag (hexa moiety M r = 0.93 kDa) to the CT segment of Cx40, Cx43 and Cx45 does not prevent the cells from forming channels.
21411628 ZO-1 regulates the rate of undocked connexon aggregation into gap junctions, enabling dynamic partitioning of Cx43 channel function between junctional and proximal nonjunctional domains of plasma membrane
21385904 Data show direct interaction between miR-218 and the 3'UTR of mRNAs encoding ROBO1, survivin (BIRC5), and connexin43 (GJA1).
21383325 This study pointed out that a rearrangement of Cx43-positive elements is part of abnormal tissue organization in FCD type IIB, and that cryptogenic epilepsies include forms with increased Cx43 mRNA expression.
21378309 Autophagy is involoved in the degradation of CX43 and CX50.
21328609 Cx-43 participation is critical for heterocellular gap junction intercellular communication between mast cells and fibroblasts.
21205823 connexin43 transcriptional suppression by TBX18 undermines cardiomyocyte cell-cell electrical coupling
21176558 Down-regulation of Cx43 expression and ultrastructure changes in the junction zone might play an important role in pathogenesis of adenomyosis.
20940304 although CIP75 can interact with ubiquitinated cellular proteins, its interaction with Cx43 and stimulation of Cx43 proteasomal degradation does not require the ubiquitination of Cx43.
20934339 In glaucomatous eyes, increased connexin43 immunoreactivity was observed at the level of the lamina cribrosa and in the peripapillary and mid-peripheral retina in association with glial activation.
20881238 hemichannels formed by Cx43 are activated by extracellular alkalinization.
20878577 Cx43 gene may be involved in the mechanism of peritoneal metastasis of gastric cancer.
20876208 Data show that Cx43 plaques on the plasma membranes of cells within KGN and NHF spheroids 24 h postseeding.
20803237 studies indicate cell surface sialic acid on cancer cells may suppress Cx43 gap junction functions via inhibiting Cx43 traffic
20684953 Androgens excess downregulates connexin 43 in granulosa cells.
20668687 Observational study of genetic testing. (HuGE Navigator)
20651379 Both aberrant localization and epigenetic changes are associated with aberrant expression of connexin 43 in human NSCLC.
20639392 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20606116 findings implicate somatic genetic defects of Cx43 as a potential cause of atrial fibrillation and support the paradigm that sporadic, nonfamilial cases of lone AF may arise from genetic mosaicism
20593197 Observational study of gene-disease association. (HuGE Navigator)
20530971 Results show that Cx40, Cx37, Cx43 and Cx45 were expressed within the glomeruli.
20512937 enhanced Cx43 expression and not gap junction-mediated communication, is involved in regulating cell cycle traverse
20512920 Our study shows for the first time that a free C-tail is sufficient to induce Cx43-dependent changes in cell morphology and that Cx43 signaling is linked to the regulation of the actin cytoskeleton.
20413811 these findings demonstrate the distribution of c-kit- and connexin 43-positive interstitial cells in the connective tissue and smooth musculature of the corpus cavernosum.
20406988 The tumor-suppressive function of Connexin43 in keratinocytes is mediated in part via interaction with caveolin-1.
20375327 In the human retina and optic nerve, connexin43 is present on glia, blood vessels, and epithelial cells.
20373058 increased expression of Cx43 and E-cadherin may contribute to the efficient metastasis of gastric cancer to the lymph nodes.
20347265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20346202 concomitant electrical pacing increased gap junction expression by paracrine action.
20233983 Cx43Hcs were found to be involved in sustaining proliferation of T cells, as assessed by cell cycle staining, thymidine incorporation assays.
20167932 Connexin 43 gap junctions with highly variable morphology are formed between cardiomyocyte lateral membranes with increased frequency in heart failure and GJ turnover likely occurs via an autophagic pathway.
20137634 Over-expression of Cx32 and Cx43 was found in samples of hippocampus from epileptic patients.
20130915 Data suggest that the three mutations in GJA1 or rhoGJA1 result in at least partial loss of normal functions carried out by CX43.
20117462 In atrial fibrillation, angiotensin II activates CTGF via activation of Rac1 and nicotinamide adenine dinucleotide phosphate oxidase, leading to up-regulation of Cx43, N-cadherin, and interstitial fibrosis.
20086016 although Panx1 and Panx3 share a common endoplasmic reticulum to Golgi secretory pathway to Cx43, their ultimate cell surface residency appears to be independent of cell contacts and the need for intact microtubules
20038810 Limited forward trafficking of connexin 43 reduces cell-cell coupling in stressed human and mouse myocardium.
19935872 Results suggest that asymmetric dimethylarginine inhibits endothelial gap junction function via downregulating Cx43 expression.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910046 Our findings suggest Cx43 and gap junction intercellular communication might be involved in the courses of occurrence, development and termination of acute leukemia
19908168 Low connexin-43 is associated with pancreatic cancer.
19883623 Studies indicate that 21 different Cxs have been detected and they are generally named according to their approximate molecular mass in Kda, e.g. Cx32, Cx43 and Cx45.
19864031 Expression of connexin 43 appears to be involved in the pathogenesis of atherosclerosis in the radial artery.
19860828 the expression of these Cx43-eYFP mutant constructs and found that the L90V mutation disrupted basolateral expression.
19854014 Observational study of gene-disease association. (HuGE Navigator)
19847613 A novel GJA1 mutation was detected in a Japanese oculodentodigital dysplasia syndrome (ODDD) patient.
19820388 Loss of functional gap junctions may occur because of the aberrant expression and localization of Cx26 and Cx43 in endometrial cancer.
19808665 analysis of intermolecular interactions between the connexin40 and connexin43 carboxyl-terminal and cytoplasmic loop domains
19808103 lack of genotype-phenotype correlation for GJA1 mutations in oculo-dento-digital dysplasia
19726320 nNOS, Pax3 and Cx43 proteins are closely related to the growth and development of the spinal cord in human embryos and fetuses.
19716642 obtained 3-dimensional structural information on the complex between the cytoplasmic loop of cx43 and calmodulin; data indicates that calmodulin binds to the peptide from cx43 in the classical 'collapsed' conformation
19710532 TGF-beta1 mediates glucose-evoked up-regulation of CX43 cell-to-cell communication in collecting tubules of the kidney.
19706598 CCN3 increases the activity of the small GTPase Rac1, thereby revealing a pathway that links Cx43 directly to actin reorganization.
19679555 Overexpression of protease-activated receptor-1 contributes to melanoma metastasis via regulation of connexin 43.
19615768 Chinese congenital heart defect patients have three novel non-synonymous genetic variants close to the hydrophobic c-terminus in connexin 43
19615768 Observational study of gene-disease association. (HuGE Navigator)
19604543 The reduced levels of Cx43 protein should not to be ascribed to a reduced genetic transcription, but to an alteration of the post-transcriptional mechanisms such as the regulation of its synthesis and/or the intracellular transport to membrane sites.
19563063 Phosphorylation of Cx43 leads to decrease in the expression, which makes ovarian cancer cells less chemosensitive.
19556520 Report novel pharmacophores of connexin43 based on the "RXP" series of Cx43-binding peptides.
19544087 Caveolin-3 (Cav3) is a new Cx43-interacting protein.
19490996 High-frequence electromagnetic field exposure significantly and selectively increased trophoblast Cx40 and Cx43, without altering protein expression.
19460861 Cx43 is a potential mediator of the neuroprotective actions of CRH
19423654 p54nrb is a transcriptional corepressor of the progesterone receptor that modulates transcription of the labor-associated gene, connexin 43 (Gja1)
19396169 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19321666 This supports a new role for ERp29 as a chaperone that helps stabilize monomeric Cx43 to enable oligomerization to occur in the Golgi apparatus.
19321193 The changes of Cx43 expression in human autoimmune thyroid disease were associated with variations in thyroid function and hormone secretion.
19297523 Cx43 and Cx32 undergo a multistep conformational maturation process in which folding of connexin monomers within the endoplasmic reticulum is a prerequisite for multisubunit assembly in the trans-Golgi network.
19297036 Cx43 mutations are not responsible for criss-cross heart in humans or are not a major cause for this defect
19174466 Cx43 establishes residency at all cell-surface membrane domains, and progressively acquires assembly states that probably reflect differences in either channel packing and/or its interactions with Cx43-binding proteins.
19084810 Their expression did not disrupt localization of endogenous PKP2, connexin-43 (Cx43), or desmoplakin (DP). However, we observed reduced abundance of Cx43 after R79x expression.
19056535 Over-expression of connexin 43 significantly induced E-cadherin expression
19027966 Observational study of gene-disease association. (HuGE Navigator)
19001515 Melatonin increased expression of the gap junction protein, connexin 43 in myometrial smooth muscle.
18988928 Observational study of gene-disease association. (HuGE Navigator)
18951659 Calcium levels in a microenvironment functionally connecting plasma membrane connexin hemichannels to downstream inositol triphosphate-dependent calcium release channels in the endoplasmic reticulum were disrupted by the connexin mimetic peptide.
18946008 mutations underlie oculodentodigital syndrome
18839320 Reduced expression of connexin 43 is associated with lung metastasis in breast cancer
18823947 Cx43 mediates the expression of an array of genes involved in human cardiogenesis, in addition to intercellular communication.
18687515 Cx43 is present in human bladder tissue both of overactive bladders and those of controls. However, it is expressed in very small amounts and is not always detectable. The role of Cx43 for the origin of detrusor overactivity remains unclear.
18675253 Clathrin associates with both connexin 43 gap junction plaques and pentilaminar gap junction vesicles.
18662195 Reduced connexin43 expression and localization to the intercalated disk occurs in heterozygous human PKP-2 mutations, potentially explaining the delayed conduction and propensity to develop arrhythmias seen in this disease.
18660473 Our evaluation not only expands the phenotypes associated with GJA1 gene mutations but also demonstrates that a great degree of variability in neurological defects.
18647409 Upregulation in tumor cell-endothelial cell contact areas in vitro and in vivo, and in areas of intratumor blood vessels and in micrometastatic foci
18636092 domain-swapped dimerization of zonula occludens-1 PDZ2 generates a distinct interface that functions together with the well-separated canonical carboxyl tail-binding pocket in each PDZ unit in binding to connexin43 (Cx43)
18600256 the level of expression, the localization and the functionality of connexin43 (Cx43) in three glioblastoma cell lines. Cx43 was responsible for the gap-junctional intercellular communication and thebystander effect
18445604 Report activation of endothelial cells to pathological status by down-regulation of connexin43.
18435417 These data suggest that changes are apparent in markers for abnormal glial-neuronal communication (connexin 43 and aquaporin 4) in brains of subjects with autism.
18425059 L113P represents a pathogenic mutation in GJA1 (Cx43) and results in oculo dentodigital dysplasia (ODDD) with marked intrafamilial variation in glaucoma type and severity.
18412120 We report here the first case of oculodentodigital dysplasia (ODDD) in a black African person, and the first case with taurodontism in ODDD, associated with a novel GJA1 mutation.
18405916 These data demonstrate the role of Cx43 in the proliferation and migration of human saphenous vein smooth muscle cells and angiotensin II-induced Cx43 expression via mitogen-activated protein kinases (MAPK)-AP-1 signaling pathway.
18396685 The decreasing expression of connexin Cx32 and Cx43 is obviously correlated with the occurrence, development and metastatic potential of stomach cancers.
18297686 These results identify JNK, and not NFkappaB, as a critical mediator of TNF-alpha repressory effect on connexin 43 gene expression.
18269311 germ line reduction of Cx43-based gap junctional intercellular communication leads to impaired osteoblast differentiation, which may account for the bone phenotypes observed in oculodentodigital dysplasia patients
18267319 Polarized Caco-2/TC7 cells express significant amounts of Cx26, Cx32 and Cx43.
18193170 Overexpression of Cx43 is associated with breast cancer cell metastatic potential
18162583 The Cx43/Cavs association occurs during exocytic transport, and they clearly indicate that caveolin regulates gap junctional intercellular communication.
18162455 Connexin 43 was absent or decreased in testis of humans with impaired spermatogesis.
18161618 Oculodentodigital dysplasia is caused by heterozygous mutations in the 6q22-q23 located GJA1 gene, that encodes connexin 43
18089569 review of autosomal dominant mutations of the genes encoding Cx26 and Cx43 [review]
18085635 found in the myocytes, but not fibroblasts, of the atrioventricular junction
18079109 A novel connexin43-interacting protein, CIP75, which belongs to the UbL-UBA protein family, regulates the turnover of connexin43
18068673 These findings indicate that Cx43 contributes to RPE differentiation via cAMP signaling.
18056766 Findings suggest that ZO-1, by interacting with Cx43, plays a role in the down-regulation and decreased size of Cx43 gap junctions in congestive heart failure.
18047584 Cx43 hyperphosphorylation induced by UVA is, at least in part, mediated through mitogen-activated protein kinase (MAPK) activation as Ser279 and Ser282 sites, two downstream direct targets of p38 MAPK found to be phosphorylated after UVA treatment.
17922338 This study investigates the responses of endothelial connexin 37, connexin 40, and connexin 43 (Cx37, Cx40, and Cx43) to shear stress and substrate.
17901047 CaM binds to a specific region of the ubiquitous gap junction protein Cx43 in a Ca(2+)-dependent manner, providing a molecular basis for the well characterized Ca(2+)-dependent inhibition of Cx43-containing gap junctions
17898133 Physiological concentrations of intracellular Ca(2+) regulate the permeability of Cx43 in a calmodulin-dependent manner that does not require the major portion of the COOH terminus of Cx43.
17895291 In myometrial smooth muscle cells, corticotropin-releasing hormone (CRH)enhances Cx43 mRNA and protein expression through upregulation of c-Fos expression. Blockade of AP-1 sites to the Cx43 promoter can neutralize the CRH-induced upregulation of Cx43.
17885214 The connexin 43 density was significantly increased in the mid-myocardium of transgenic hearts compared with wild type in hypertrophic cardiomyopathy
17878326 levels of connexin-43 are below those detectable by immunofluorescence
17760848 It is concluded that in patients with heart failure, down-regulation of ZO-1 matches the diminished expression levels of connexin 43, suggesting that ZO-1 plays an important role in gap junction formation and gap junction plaque stability.
17708781 Cx43 expression level and gap junction function in acute leukemia bone marrow stromal cells was lower than in normal cells.
17687502 the increased hemichannel activity may be directly caused by an altered conformation of the mutated channel forming protein in patiets with oculodentodigital dysplasia
17624368 Connexin43 expression can be influenced by Ang II and IGF-1 through ERK and p38 pathways and may contribute to the pathogenesis of vein graft disease following coronary artery bypass grafting.
17572641 as in primary cultured limbal epithelial cells, Cx43 expression and extent of GJIC may serve as markers for the differentiation status of nasal epithelial cells.
17551925 Activation of the EGFR pathway in response to HP leads to decrease of GJIC via tyrosine phosphorylation of Cx43 in ONH astrocytes. In glaucoma, astrocytes may lose GJIC altering the homeostasis of RGC axons.
17541973 the interaction between Cx43 and ZO-1 is regulated by the proteasome
17486593 Cx43 expression level could influence the action of Endothelin-1 on human osteoblastic cell differentiation
17420259 The potency difference in the dominant negative properties of Cx43 mutants may have clinical implications for the various symptoms and disease severity observed in oculodentodigital dysplasia patients.
17275998 Cx43 expression may be in part responsible for the malignancy of hepatoma cells through a decrease in GJIC composed of Cx32
17189315 Cx40/Cx45 junctions demonstrate electrical signal transfer asymmetry that can be modulated between unidirectional and bidirectional by small changes in the difference between holding potentials of the coupled cells.
17183550 Cx43 was colocalized with actin in tenocytes; colocalization increased significantly after cyclic strain
17143533 A rational strategy for treating patients with advanced hormone refractory prostate cancer using CX43 gene therapy and docetaxel.
17072341 Inhibition of Cx43 function in high expressing cells led to an increase in drug resistance.
16958087 We conclude that activation of the innate immune response in astrocytes is associated with functional loss of CX43 through a pathway involving NF-kappaB and PI3 kinase.
16891658 the 46 aberrant amino acid residues of GJA1 associated with the frameshift mutant are, at least in part, responsible for the manifestation of palmoplantar keratoderma symptoms
16886200 These findings suggested that the brain may generate neuronal protection by increasing the levels of Cx43 and amplifying the astrocytic gap junctional intercellular communication under hypoxic condition.
16823880 Based on these data, we propose a working hypothesis in which Cx43 could be an intermediate target for T3 inhibition of neonatal Sertoli cell proliferation.
16820904 Cx43 plays a role as a tumor suppressor, however, no definite correlation was found between Cx43 and cell migration and invasion.
16820096 connexin 43 is downregulated in Sertoli cells and germ cells during the transition from preinvasive carcinoma in situ to seminoma
16816024 Oculodentodigital syndrome is inherited as an autosomal dominant trait, results from missense mutations in the gap junction protein connexin 43.
16741927 Conditional expression of AML1-ETO by the ecdysone-inducible system dramatically increases the expression of connexin 43 together with growth arrest at G1 phase in leukemic U937 cells.
16684925 Cx43 expression and cell-to-cell communication increased in response to high glucose and may protect the collecting duct from renal damage associated with more established diabetic nephropathy.
16677845 The present review highlights the emerging role of connexin43 in the physiology and physiopathology of human erectile function and its possible medical application.
16675599 downregulation of Cx43 expression by high glucose promotes the senescence of glomerular mesangial cells, which may be involved in the pathogenesis of diabetic nephropathy
16674815 High expression of connexin 43 & syndecan 3 & their co-localization to smooth muscle bundles during normal labour, with significant reduction in prolonged labour, may indicate a role for these proteins in co-ordination of myometrial contractility.
16647893 Detected with RT-PCR profiling in ovarian cancer cells.
16638984 The frequency of mutations in the FOXC1, GJA1, PITX2, and CYP1B1 genes in this study were 25%, 12.5%, 0% and 0%, respectively.
16580773 Results showed that Cx43 was phosphorylated during lung tumorigenesis.
16480955 revealed a significant influence of cardiopulmonary bypass and the underlying heart defect on Cx43 expression
16442184 Results demonstrate that TGF-beta1 significantly up-regulates connexin 43 expression and intercellular communication, in concert with increased expression of alpha-actin, calponin and SM1.
16424398 This study evaluated whether the gap junction protein connexin (Cx) 43 could serve as a negative cell surface marker for human corneal epithelial stem cells. Cx43 expression was evaluated in corneo-limbal tissue and primary limbal epithelial cultures.
16407179 Cx26 and Cx43 have roles in closed gap junction channel formation
16378922 GJA1 mutations is associated with oculo-dento-digital dysplasia
16361362 This is the first study to demonstrate that flow simultaneously and differentially regulates expression of the Cx37, Cx40, and Cx43 proteins.
16319124 These results suggest that gap junctional intercellular communication and expression of Cx43 contribute to alkaline phosphatase activity, as well as osteocalcin, osteopontin, and Cbfa1 expression in osteoblastic cells.
16219735 Our results demonstrate a new mutation (P59H) in the GJ1A gene, identified in a family with ODDD (oculodentodigital dysplasia) syndrome.
16112082 These results suggest that the newly identified domain is essential for the proper phosphorylation and localization of Cx43, and CIP150 is a novel partner protein targeting this domain.
16103109 aquaporin-4 has species-specific roles in astrocytes and a functional relationship with Connexin43
16010294 Disturbances in both the expression and distribution of Cx43 were found in children with tetralogy of Fallot
15987459 study demonstrated for the first time that Cx43 protein can be localized at the cell-cell interface between endothelial cells and tumor cells during the process of diapedesis
15979566 These data suggest that Cx43del(130-136) produces connexin-specific inhibition of intercellular communication through formation of heteromeric connexons that are non-functional and/or retained in the cytoplasm.
15978203 Observational study of gene-disease association. (HuGE Navigator)
15948121 Phosphorylated Cx43, is up-regulated in hyperplasias and dysplasias and fibroadenoma and is strongly up-regulated in invasive carcinomas.
15944608 Connexin43 is increased in vitro during process of intimal hyperplasia, supporting a critical role for Cx43-mediated gap-junctional communication in the human vein during the development of intimal hyperplasia.
15870276 existence of internal ribosome entry sites in connexin mRNAs permits connexin expression in density-inhibited or differentiated cells, where cap-dependent translation is generally reduced
15817491 charged residues present in Cx43 and related connexins help prevent endoplasmic reticulum oligomerization by stabilizing the third transmembrane domain in the membrane bilayer
15704645 The connexin 43 expression was seen in the circular layer of muscularis externa.
15576650 In nonischemic heart failure in humans, there is a decrease in both Cx43 expression and phosphorylation that contributes to uncoupling.
15534005 PKC-dependent phosphorylation of Cx43 at S368 creates dynamic communication compartments that can temporally and spatially regulate wound healing.
15338868 Laryngeal cancer presented inactivation of Cx43 gene and E-cad gene and down regulation of Cx43 and E-cad proteins.
15334670 mRNA level correlates with cell differentiation, nd is predictive of postoperative recurrence in hepatocellular carcinoma.
15181016 Cx43 is able to regulate cell growth via an up-regulation of NOV transcription
15140236 the downregulation of Cx43 is an important event in human wound healing.
14974090 Homozygous GJA1 point mutations in a conserver codon, one base change results in a Oculodentodigital dysplasia phenotype in one patient, another base change in the same codon resultes in a Hallermann-Streiff syndrome phenotype in another patient.
14766937 Staining for Cx43 and Cx40 along regions of intimate cell-to-cell contact between human mesenchymal stem cells.
14729836 A missense mutation in the cytoplasmic loop of GJA1 results in an atypical ophthalmological phenotype, displaying type III syndactyly but not the characteristic dental or skeletal features.
14713573 Low doses of ionizing radiation induce the transcriptional upregulation of connexin 43 expression employing NFAT and AP1 sites.
14681024 Opening of non-junctional connexin 43 (Cx43) hemichannels plays a role in cell physiology
14667880 mRNA levels of connexins in different sizes of luteinized normal and hyperstimulated follicles.
14639017 Heterogeneous expression of Cx 43 protein may contribute to impaired ventricular conduction.
14519646 Cx43 mRNA in adjacent normal tissue surrounding lung tumor simply detected by RT-PCR may act as a molecular marker of nodal micrometastasis in non-small cell lung cancer.
13130072 examination of gating and regulation of hemichannels
12907686 connexin 43 is phosphorylated in ovarian tumor cells and has a role in gap junctional intercellular communication
12881039 mouse connexin43 promoter is regulated by GDF5 in osteoblasts ans embryos
12861055 the point mutations in the second extracellular region of Cx43 do not affect the ability of the mutant proteins in vitro to suppress cell growth
12840075 Cx43 is directly involved in human trophoblast cell-cell communication, fusion and differentiation.
12767974 proteasomal degradation regulates the stability of phosphorylated Cx43 and appears to promote the internalization of Cx43 from the cell surface
12730291 the tyrosine-based motif of human connexin43 is a prime determinant controlling connexin43 stability, and consequently GJC, by targeting connexin43 for degradation in the endocytic/lysosomal compartment.
12717835 gap junctional intercellular communication in hepatocellular carcinoma cell lines, and signal transduction mechanism of gap junction genes connexin32, connexin43 in hepatocarcinogenesis
12644583 the transcriptional up-regulation of Cx43 by Ras-Raf-MAPK is mediated via the interaction of a novel Cx43 promoter element with a protein complex that contains both HSP90 and c-Myc.
12637502 connexin 43 gap junction communication induced by EGF is regulated by ERK5
12619876 Focal disorganization of gap junction distribution and downregulation of Cx43 are typical of myocardial remodeling that may play an important role in the development of an arrhythmogenic substrate in human cardiomyopathies
12619863 plasma membrane localization and formation of channels are not required for growth inhibition by Cx43, and nuclear localization of CT-Cx43 may exert effects on gene expression and growth
12489165 Connexin 43 in human teeth. Tooth development, Cx43 in epithelial and mesenchymal dental cells. Adult teeth, Cx43 in odontoblasts. Cx43 downregulated in mature teeth, upregulated in odontoblasts facing caries. In dental pulp Cx43 in mineralized nodules.
12484567 These findings suggest that expression of Cx26 and Cx43 might be related to the differentiation of the arachnoid villi and meningiomas, and exhibit the different origin of various subtypes of meningiomas.
12457340 We found mutations in the GJA1 gene in all 17 families with oculodentodigital dysplasia that we screened.
12452056 abnormal expression of connexin43 and connexin45 in nasopharynx tissues may be associated with cancerization and squamatization of human nasopharynx tissue
12397213 Our data show that the presence of Cx43 allows an inter-trophoblastic GJIC and is associated with the fusion process leading to the villous syncytiotrophoblast
12205082 alpha-catenin facilitates trafficking of connexins 32 and 43 to the cell surface and induces gap junction assembly
12203365 and expression of the transcription factor E2F1 correlated inversely with tumor grade
12064631 Results provide evidence for Cx43 being targeted to lysosomes as a result of misfolding and aggregation, while in other cases, the delivery of wild-type Cx43 to lysosomes appears to be due to defects innate to the breast tumor cell type.
12064622 Results establish a role for connexin43 hemichannels in bisphosphonate action, and a novel function of connexin43 in the regulation of survival signaling pathways.
12064615 Data suggest that the dynamic changes of connexins 43, 40 and 45 during mouse cardiac development appear to be mirrored in the human.
12042301 overexpression of Cx43 or Cx26 in breast cancer cells down-regulated fibroblast growth factor receptor-3
12019157 Connexin 43 suppresses human glioblastoma cell growth by down-regulation of monocyte chemotactic protein 1, as discovered using protein array technology.
12003820 homocysteine (Hcy)-induced upregulation of Cx43 transcript and protein expression are associated with unaltered intercellular communication and redistribution of Cx43 in HUVEC
11815667 The fast transjunctional voltage-sensitive gating mechanism of Cx43 cell-cell channel can serve as a selectivity filter, which allows electrical coupling but limits metabolic communication.
11746825 results demonstrate a new role of Cx43 in the mediation of apoptosis under low serum conditions
11741942 This evidence adds Cx-43 to the list of transmembrane proteins capable of transducing survival signals in response to extracellular cues and raises the possibility that it may serve in this capacity for endogenously produced molecules or even other drugs.
11470490 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSF      1 - 70
PISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE     71 - 140
EHGKVKMRGGLLRTYIISILFKSIFEVAFLLIQWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTIFI    141 - 210
IFMLVVSLVSLALNIIELFYVFFKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSP    211 - 280
MSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAG    281 - 350
HELQPLAIVDQRPSSRASSRASSRPRPDDLEI                                          351 - 382
//

Text Mined References (461)

PMID Year Title
26902399 2016 High glucose induces dysfunction of airway epithelial barrier through down-regulation of connexin 43.
26869446 2016 Linoleic acid permeabilizes gastric epithelial cells by increasing connexin 43 levels in the cell membrane via a GPR40- and Akt-dependent mechanism.
26823747 2015 Roles of Cx43 and AKAP95 in ovarian cancer tissues in G1/S phase.
26784020 2016 Connexin 43 Affects Osteogenic Differentiation of the Posterior Longitudinal Ligament Cells via Regulation of ERK Activity by Stabilizing Runx2 in Ossification.
26586821 2015 Astroglial Connexin 43 Hemichannels Modulate Olfactory Bulb Slow Oscillations.
26543049 2016 Modelling maternal obesity: the effects of a chronic high-fat, high-cholesterol diet on uterine expression of contractile-associated proteins and ex vivo contractile activity during labour in the rat.
26517241 2015 Increased expression of CX43 on stromal cells promotes leukemia apoptosis.
26491675 2015 AR Pathway Is Involved in the Regulation of CX43 in Prostate Cancer.
26481195 2015 Interaction of Cx43 with Hsc70 regulates G1/S transition through CDK inhibitor p27.
26450928 2015 miR-381 suppresses C/EBP?-dependent Cx43 expression in breast cancer cells.
26446715 2015 All-trans retinoic acid arrests cell cycle in leukemic bone marrow stromal cells by increasing intercellular communication through connexin 43-mediated gap junction.
26445057 2015 HPV16 E6 Controls the Gap Junction Protein Cx43 in Cervical Tumour Cells.
26442583 2015 Mitogen-activated Protein Kinase (MAPK) Activated by Prostaglandin E2 Phosphorylates Connexin 43 and Closes Osteocytic Hemichannels in Response to Continuous Flow Shear Stress.
26398895 2015 Connexin43 Inhibition Prevents Human Vein Grafts Intimal Hyperplasia.
26376117 2015 Connexin43-containing gap junctions potentiate extracellular Ca²?-induced odontoblastic differentiation of human dental pulp stem cells via Erk1/2.
26349540 2015 Manipulating Cx43 expression triggers gene reprogramming events in dermal fibroblasts from oculodentodigital dysplasia patients.
26335100 2015 The carboxy-terminal domain of connexin 43 (CT-Cx43) modulates the expression of p53 by altering miR-125b expression in low-grade human breast cancers.
26334722 2016 Connexin 43 promotes ossification of the posterior longitudinal ligament through activation of the ERK1/2 and p38 MAPK pathways.
26324251 2015 Connexin 43 expressed in endothelial cells modulates monocyte?endothelial adhesion by regulating cell adhesion proteins.
26318481 2015 Infection by Cx43 adenovirus increased chemotherapy sensitivity in human gastric cancer BGC-823 cells: not involving in induction of cell apoptosis.
26299454 2015 Eventual proapoptotic or anti-apoptotic impact of aberrantly expressed Cx43 and Cx26 can depend on ER-alpha overexpression in human endometrioid adenocarcinoma.
26283635 2015 Identification of miR-200a as a novel suppressor of connexin 43 in breast cancer cells.
26255026 2015 Cx43 increases serum induced filopodia formation via activation of p21-activated protein kinase 1.
26251520 2015 Connexin 43 expression predicts poor progression-free survival in patients with non-muscle invasive urothelial bladder cancer.
26221040 2015 The Selective Degradation of Synaptic Connexin 43 Protein by Hypoxia-induced Autophagy Impairs Natural Killer Cell-mediated Tumor Cell Killing.
26202915 2015 Transforming growth factor-?1 up-regulates connexin43 expression in human granulosa cells.
26191122 2015 Altered expression of connexin43 and phosphorylation connexin43 in glioma tumors.
26189259 2015 Cervical squamous cancer mRNA profiles reveal the key genes of metastasis and invasion.
26186970 2015 Transforming growth factor-? stimulates human ovarian cancer cell migration by up-regulating connexin43 expression via Smad2/3 signaling.
26135897 2015 Overexpression of connexin 43 reduces melanoma proliferative and metastatic capacity.
26046157 2015 No evidence for clinical utility in investigating the connexin genes GJB2, GJB6 and GJA1 in non-syndromic hearing loss in black Africans.
26031779 2016 EGF-Induced Connexin43 Negatively Regulates Cell Proliferation in Human Ovarian Cancer.
26025955 2015 MicroRNA-1298 is regulated by DNA methylation and affects vascular smooth muscle cell function by targeting connexin 43.
26018820 2015 Oxygen Sensitivity of Placental Trophoblast Connexins 43 and 46: A Role in Preeclampsia?
26011388 2015 Intracellular spermine prevents acid-induced uncoupling of Cx43 gap junction channels.
26009201 2015 Protein kinase C-dependent regulation of connexin43 gap junctions and hemichannels.
26009200 2015 Electrical consequences of cardiac myocyte: fibroblast coupling.
26009199 2015 Gap junctions - guards of excitability.
26009195 2015 Connexin43 plays diverse roles in co-ordinating cell migration and wound closure events.
26009194 2015 To beat or not to beat: degradation of Cx43 imposes the heart rhythm.
26009193 2015 Connexin 43 ubiquitination determines the fate of gap junctions: restrict to survive.
26002762 2015 Tumor-induced loss of mural Connexin 43 gap junction activity promotes endothelial proliferation.
25976645 2015 A novel truncation mutation in GJA1 associated with open angle glaucoma and microcornea in a large Chinese family.
25960544 2015 Connexin 43 expression is associated with increased malignancy in prostate cancer cell lines and functions to promote migration.
25959821 2015 Differential connexin function enhances self-renewal in glioblastoma.
25952184 2015 The role of connexin 43 in mediating odor response.
25933380 2015 Prognostic impact of reduced connexin43 expression and gap junction coupling of neoplastic stromal cells in giant cell tumor of bone.
25926558 2015 Reduction in gap junction intercellular communication promotes glioma migration.
25903580 2015 Proteomic Analysis of Connexin 43 Reveals Novel Interactors Related to Osteoarthritis.
25901741 2015 GATA-3 augmentation down-regulates Connexin43 in Helicobacter pylori associated gastric carcinogenesis.
25873300 2015 Regulation of connexin 43 and microRNA expression via ?2-adrenoceptor signaling in 1321N1 astrocytoma cells.
25843295 2015 Connexin-43 downregulation in G2/M phase enriched tumour cells causes extensive low-dose hyper-radiosensitivity (HRS) associated with mitochondrial apoptotic events.
25815348 2015 Connexin 43 communication channels in follicular dendritic cell development and in follicular lymphomas.
25760687 2015 Inhibition of connexin 43 hemichannel-mediated ATP release attenuates early inflammation during the foreign body response.
25625422 2015 Keratitis-ichthyosis-deafness syndrome-associated Cx26 mutants produce nonfunctional gap junctions but hyperactive hemichannels when co-expressed with wild type Cx43.
25584940 2015 Expression and function of connexin 43 in human gingival wound healing and fibroblasts.
25583071 2015 Degradation of gap junction connexins is regulated by the interaction with Cx43-interacting protein of 75 kDa (CIP75).
25560303 2015 TGF-?1 up-regulates connexin43 expression: a potential mechanism for human trophoblast cell differentiation.
25504652 2015 Human Connexin43E42K mutation from a sudden infant death victim leads to impaired ventricular activation and neonatal death in mice.
25496568 2014 Connexin43 enhances the expression of osteoarthritis-associated genes in synovial fibroblasts in culture.
25401181 2014 Alterations in gap junction connexin43/connexin45 ratio mediate a transition from quiescence to excitation in a mathematical model of the myometrium.
25398053 2015 Dominant De Novo Mutations in GJA1 Cause Erythrokeratodermia Variabilis et Progressiva, without Features of Oculodentodigital Dysplasia.
25386667 2015 N-cadherin, beta-catenin and connexin 43 expression in astrocytic tumours of various grades.
25383624 2014 Correlations of differentially expressed gap junction connexins Cx26, Cx30, Cx32, Cx43 and Cx46 with breast cancer progression and prognosis.
25270527 2015 Down-regulation of connexin43 and connexin32 in keratocystic odontogenic tumours: potential association with clinical features.
25239217 2014 1,25-Dihydroxyvitamin D3 increases testosterone-induced 17beta-estradiol secretion and reverses testosterone-reduced connexin 43 in rat granulosa cells.
25227101 2014 Expression of Cx43 and Pax3 proteins in the human placental villi and decidua during early pregnancy.
25206281 2014 Connexin 32 and 43 promoter methylation in Helicobacter pylori-associated gastric tumorigenesis.
25168385 2015 Exome sequencing reveals mutation in GJA1 as a cause of keratoderma-hypotrichosis-leukonychia totalis syndrome.
25124494 2014 Integrating genetic, transcriptional, and functional analyses to identify 5 novel genes for atrial fibrillation.
25110696 2014 Connexin 43 expression on peripheral blood eosinophils: role of gap junctions in transendothelial migration.
25070368 2014 AMSH-mediated deubiquitination of Cx43 regulates internalization and degradation of gap junctions.
24967639 2014 Gap junction protein connexin43 exacerbates lung vascular permeability.
24833468 2014 Connexin43 siRNA promotes HUVEC proliferation and inhibits apoptosis induced by ox-LDL: an involvement of ERK signaling pathway.
24819345 2014 Downregulation of connexin43 by microRNA-130a in cardiomyocytes results in cardiac arrhythmias.
24815435 2014 Pathological implications of Cx43 down-regulation in human colon cancer.
24789679 2014 Cx43 reverses the resistance of A549 lung adenocarcinoma cells to cisplatin by inhibiting EMT.
24788723 2014 Membrane connexin 43 acts as an independent prognostic marker in oral squamous cell carcinoma.
24785695 2014 In search of genetic markers for nonsyndromic deafness in Africa: a study in Cameroonians and Black South Africans with the GJB6 and GJA1 candidate genes.
24774648 2014 Reduced connexin 43 immunolabeling in the orbitofrontal cortex in alcohol dependence and depression.
24751918 2014 On the role of the gap junction protein Cx43 (GJA1) in human cardiac malformations with Fallot-pathology. a study on paediatric cardiac specimen.
24742583 2014 Sulforaphane counteracts aggressiveness of pancreatic cancer driven by dysregulated Cx43-mediated gap junctional intercellular communication.
24724781 2015 Up-regulation of connexin-43 expression in bone marrow mesenchymal stem cells plays a crucial role in adhesion and migration of multiple myeloma cells.
24675463 2014 Temozolomide resistance in glioblastoma cells occurs partly through epidermal growth factor receptor-mediated induction of connexin 43.
24636551 2014 In vitro and in vivo characteristics of connexin 43-modified human skeletal myoblasts as candidates for prospective stem cell therapy for the failing heart.
24508941 2014 Three novel GJA1 missense substitutions resulting in oculo-dento-digital dysplasia (ODDD) - further extension of the mutational spectrum.
24503443 2014 Functional links between Snail-1 and Cx43 account for the recruitment of Cx43-positive cells into the invasive front of prostate cancer.
24500718 2014 Protein kinase C?-mediated phosphorylation of Connexin43 gap junction channels causes movement within gap junctions followed by vesicle internalization and protein degradation.
24457967 2014 A cell-penetrating peptide based on the interaction between c-Src and connexin43 reverses glioma stem cell phenotype.
24457961 2014 Cross-regulation of Connexin43 and ?-catenin influences differentiation of human neural progenitor cells.
24445236 2014 Establishment of neurogenic microenvironment in the neurovascular unit: the connexin 43 story.
24434540 2014 Syndromic and non-syndromic disease-linked Cx43 mutations.
24413384 2014 Oocyte-derived BMP15 but not GDF9 down-regulates connexin43 expression and decreases gap junction intercellular communication activity in immortalized human granulosa cells.
24376266 2014 Gap junction intercellular communications regulate NK cell activation and modulate NK cytotoxic capacity.
24368520 2014 Immunohistochemistry of connexin43 and zonula occludens-1 in the myocardium as markers of early ischemia in autopsy material.
24294380 2013 Clinical usefulness of immunohistochemistry for plakoglobin, N-cadherin, and connexin-43 in the diagnosis of arrhythmogenic right ventricular cardiomyopathy.
24270393 2014 Reduced connexin 43 in eutopic endometrium and cultured endometrial stromal cells from subjects with endometriosis.
24241398 2014 Possible role of gap junction intercellular channels and connexin 43 in satellite glial cells (SGCs) for preservation of human spiral ganglion neurons : A comparative study with clinical implications.
24213533 2014 Injury-triggered Akt phosphorylation of Cx43: a ZO-1-driven molecular switch that regulates gap junction size.
24210816 2013 Autoregulation of connexin43 gap junction formation by internally translated isoforms.
24146179 2014 Expression of Cx43-related microRNAs in patients with tetralogy of Fallot.
24134157 2014 HIV increases the release of dickkopf-1 protein from human astrocytes by a Cx43 hemichannel-dependent mechanism.
24119489 Connexin 32 and 43 mutations: do they play a role in chronic rhinosinusitis?
24056538 2013 Connexin43 functions as a novel interacting partner of heat shock cognate protein 70.
24046143 2013 miR-125b inhibits Connexin43 and promotes glioma growth.
24040271 2013 Aberrant expression of Cx43 is associated with the peritoneal metastasis of gastric cancer and Cx43-mediated gap junction enhances gastric cancer cell diapedesis from peritoneal mesothelium.
23991165 2013 Connexin 43 astrocytopathy linked to rapidly progressive multiple sclerosis and neuromyelitis optica.
23978378 2014 Human cytomegalovirus immediate early proteins promote degradation of connexin 43 and disrupt gap junction communication: implications for a role in gliomagenesis.
23951358 2013 A novel autosomal recessive GJA1 missense mutation linked to Craniometaphyseal dysplasia.
23922689 2013 hESC expansion and stemness are independent of connexin forty-three-mediated intercellular communication between hESCs and hASC feeder cells.
23828237 2013 Effects of phosphorylation on the structure and backbone dynamics of the intrinsically disordered connexin43 C-terminal domain.
23819010 2013 17-?-Estradiol counteracts the effects of high frequency electromagnetic fields on trophoblastic connexins and integrins.
23800357 2013 Connexin-43 can delay early recurrence and metastasis in patients with hepatitis B-related hepatocellular carcinoma and low serum alpha-fetoprotein after radical hepatectomy.
23768164 2013 Role of the JNK signaling pathway in downregulation of connexin43 by TNF-? in human corneal fibroblasts.
23750535 2013 Isolation of pluripotent neural crest-derived stem cells from adult human tissues by connexin-43 enrichment.
23706332 2013 Claudin-11 and connexin-43 display altered spatial patterns of organization in men with primary seminiferous tubule failure compared with controls.
23679094 2013 Polymorphisms in FGF12, VCL, CX43 and VAX1 in Brazilian patients with nonsyndromic cleft lip with or without cleft palate.
23678036 2013 Effects of PGF2? on the expression of uterine activation proteins in pregnant human myometrial cells from upper and lower segment.
23621211 2013 Expression of connexin 43 and E-cadherin protein and mRNA in non-small cell lung cancers in Chinese patients.
23606748 2013 Autosomal recessive GJA1 (Cx43) gene mutations cause oculodentodigital dysplasia by distinct mechanisms.
23586710 2013 The connexin43-interacting protein, CIP85, mediates the internalization of connexin43 from the plasma membrane.
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
23579271 2013 Gap junctional communication promotes apoptosis in a connexin-type-dependent manner.
23568744 2013 [Expression of connexin 43 in tongue carcinogenesis].
23550541 2013 A novel mutation in GJA1 causing oculodentodigital syndrome and primary lymphoedema in a three generation family.
23544880 2013 The distribution and functional properties of Pelizaeus-Merzbacher-like disease-linked Cx47 mutations on Cx47/Cx47 homotypic and Cx47/Cx43 heterotypic gap junctions.
23420013 2013 Connexin 43 is involved in the generation of human-induced pluripotent stem cells.
23386650 2013 Theca-derived BMP4 and BMP7 down-regulate connexin43 expression and decrease gap junction intercellular communication activity in immortalized human granulosa cells.
23381804 2013 Mutated desmoglein-2 proteins are incorporated into desmosomes and exhibit dominant-negative effects in arrhythmogenic right ventricular cardiomyopathy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23376080 2013 Negatively charged residues (Asp378 and Asp379) in the last ten amino acids of the C-terminal tail of Cx43 hemichannels are essential for loop/tail interactions.
23363606 2013 Phosphorylation on Ser-279 and Ser-282 of connexin43 regulates endocytosis and gap junction assembly in pancreatic cancer cells.
23354732 2013 Reduction of connexin43 in human endothelial progenitor cells impairs the angiogenic potential.
23348765 2013 Novel germline GJA5/connexin40 mutations associated with lone atrial fibrillation impair gap junctional intercellular communication.
23344009 2013 Melanocytic tumors express connexin 43 but not 26: immunohistochemical analysis with potential significance in melanocytic oncogenesis.
23328809 2013 The role of connexin 43 and hemichannels correlated with the astrocytic death following ischemia/reperfusion insult.
23322705 2013 The regulation of runt-related transcription factor 2 by fibroblast growth factor-2 and connexin43 requires the inositol polyphosphate/protein kinase C? cascade.
23257890 2013 Effects of different sustained hydrostatic pressures on connexin 43 in human bladder smooth muscle cells.
23255671 2012 Reversible atrial gap junction remodeling during hypoxia/reoxygenation and ischemia: a possible arrhythmogenic substrate for atrial fibrillation.
23183192 2013 Common genetic variation near the connexin-43 gene is associated with resting heart rate in African Americans: a genome-wide association study of 13,372 participants.
23178689 2013 Remodeling of the cardiac sodium channel, connexin43, and plakoglobin at the intercalated disk in patients with arrhythmogenic cardiomyopathy.
23151788 2012 Cx43, ZO-1, alpha-catenin and beta-catenin in cataractous lens epithelial cells.
23095853 2012 Connexin mimetic peptides inhibit Cx43 hemichannel opening triggered by voltage and intracellular Ca2+ elevation.
23042455 2013 Retinoic acid regulates gap junction intercellular communication in human endometrial stromal cells through modulation of the phosphorylation status of connexin 43.
22951570 2012 Construction of recombinant adenovirus vector with connexin 43 gene.
22918484 2013 Connexin 43 a check-point component of cell proliferation implicated in a wide range of human testis diseases.
22889254 2013 Detection of genomic deletions of PKP2 in arrhythmogenic right ventricular cardiomyopathy.
22809623 2012 Structure and functional studies of N-terminal Cx43 mutants linked to oculodentodigital dysplasia.
22785209 2012 Suppression of CX43 expression by miR-20a in the progression of human prostate cancer.
22775996 2012 The G60S Cx43 mutant enhances keratinocyte proliferation and differentiation.
22736223 2012 Connexin 43 interacts with Bax to regulate apoptosis of pancreatic cancer through a gap junction-independent pathway.
22729648 2012 Inducible coexpression of connexin37 or connexin40 with connexin43 selectively affects intercellular molecular transfer.
22657348 2012 A functional interaction between the MAGUK protein hDlg and the gap junction protein connexin 43 in cervical tumour cells.
22615994 2012 Targeting Cx43 and N-cadherin, which are abnormally upregulated in venous leg ulcers, influences migration, adhesion and activation of Rho GTPases.
22590817 2012 Aberrant connexin 43 and 26 expression in cervical dysplasia.
22558917 2012 Phosphorylation controls the interaction of the connexin43 C-terminal domain with tubulin and microtubules.
22455314 2012 Overexpression of the gap junction protein Cx43 as found in diabetic foot ulcers can retard fibroblast migration.
22446325 2012 Monocyte-endothelial adhesion is modulated by Cx43-stimulated ATP release from monocytes.
22430144 2012 The role of the Cx43 C-terminus in GJ plaque formation and internalization.
22422398 2012 Gating of connexin 43 gap junctions by a cytoplasmic loop calmodulin binding domain.
22417726 2012 AGEs-RAGE mediated up-regulation of connexin43 in activated human microglial CHME-5 cells.
22411987 2012 The gap junction channel protein connexin 43 is covalently modified and regulated by SUMOylation.
22405962 2012 Disturbed myocardial connexin 43 and N-cadherin expressions in hypoplastic left heart syndrome and borderline left ventricle.
22399755 2012 Critical role of connexin 43 in secondary expansion of traumatic spinal cord injury.
22389404 2012 CASK (LIN2) interacts with Cx43 in wounded skin and their coexpression affects cell migration.
22259903 Absence of GJA1 gene mutations in four patients with anomalous left coronary artery from the pulmonary artery (ALCAPA).
22238282 2012 The molecular role of connexin 43 in human trophoblast cell fusion.
22230328 2012 Role of connexin 43 in the mechanism of action of alendronate: dissociation of anti-apoptotic and proliferative signaling pathways.
22180603 2012 Connexin43 regulates sodium current; ankyrin-G modulates gap junctions: the intercalated disc exchanger.
22179534 2012 Connexin43 mutation causes heterogeneous gap junction loss and sudden infant death.
22155212 2012 Channel-independent influence of connexin 43 on cell migration.
22141269 2011 [Gossypol decreases the expression of connexin 43 in Sertoli cells].
22131169 2012 Connexin 43 reverses malignant phenotypes of glioma stem cells by modulating E-cadherin.
22112812 2012 Gonadotropin-releasing hormone-I or -II interacts with IGF-I/Akt but not connexin 43 in human granulosa cell apoptosis.
22080401 2012 The gap junction protein Cx43 is involved in the bone-targeted metastatic behaviour of human prostate cancer cells.
22049024 2012 Gap junction assembly: roles for the formation plaque and regulation by the C-terminus of connexin43.
22033928 2011 Connexin-43 hemichannels mediate cyclic ADP-ribose generation and its Ca2+-mobilizing activity by NAD+/cyclic ADP-ribose transport.
22012769 Connexin expression by human granulosa cell tumors: Identification of connexin 32 as a tumor signature.
21872657 2012 Increased interaction of connexin43 with zonula occludens-1 during inhibition of gap junctions by G protein-coupled receptor agonists.
21866551 2012 Connexin43 acts as a colorectal cancer tumor suppressor and predicts disease outcome.
21858092 2011 Premature osteoblast clustering by enamel matrix proteins induces osteoblast differentiation through up-regulation of connexin 43 and N-cadherin.
21856279 2012 The connexin43 carboxyl terminus and cardiac gap junction organization.
21839722 2012 Functional consequences of abnormal Cx43 expression in the heart.
21819962 2012 Connexin43 phosphorylation in brain, cardiac, endothelial and epithelial tissues.
21763271 2012 Connexin43 phosphorylation and cytoprotection in the heart.
21727092 2011 Enhanced activation of p21-activated kinase 1 in heart failure contributes to dephosphorylation of connexin 43.
21726529 2011 Regulation of gap junction function and Connexin 43 expression by cytochrome P450 oxidoreductase (CYPOR).
21718795 2011 Suppression of lung cancer cell invasion and metastasis by connexin43 involves the secretion of follistatin-like 1 mediated via histone acetylation.
21716323 2011 The G60S connexin43 mutant regulates hair growth and hair fiber morphology in a mouse model of human oculodentodigital dysplasia.
21670345 2011 Oculodentodigital dysplasia: new ocular findings and a novel connexin 43 mutation.
21669459 2011 Reduced expression of gap junction gene connexin 43 in recurrent early pregnancy loss patients.
21665377 2011 Low concentrations of alendronate increase the local invasive potential of osteoblastic sarcoma cell lines via connexin 43 activation.
21642545 2011 Connexin 43 signaling enhances the generation of Foxp3+ regulatory T cells.
21606502 2011 Investigation of the reciprocal relationship between the expression of two gap junction connexin proteins, connexin46 and connexin43.
21538160 2011 Sox4 mediates Tbx3 transcriptional regulation of the gap junction protein Cx43.
21532342 Enhanced PKC? mediated phosphorylation of connexin43 at serine 368 by a carboxyl-terminal mimetic peptide is dependent on injury.
21442291 2011 Mechanical strain induces Cx43 expression in spinal ligament fibroblasts derived from patients presenting ossification of the posterior longitudinal ligament.
21424225 2011 Influence of v5/6-His tag on the properties of gap junction channels composed of connexin43, connexin40 or connexin45.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21411628 2011 Connexin 43 connexon to gap junction transition is regulated by zonula occludens-1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21385904 2011 MiR-218 suppresses nasopharyngeal cancer progression through downregulation of survivin and the SLIT2-ROBO1 pathway.
21383325 2011 Expression of connexin 43 in the human epileptic and drug-resistant cerebral cortex.
21378309 2011 Autophagy: a pathway that contributes to connexin degradation.
21328609 2011 Modulatory effects of connexin-43 expression on gap junction intercellular communications with mast cells and fibroblasts.
21220045 2011 A novel desmocollin-2 mutation reveals insights into the molecular link between desmosomes and gap junctions.
21205823 2011 Transcriptional suppression of connexin43 by TBX18 undermines cell-cell electrical coupling in postnatal cardiomyocytes.
21176558 2010 [Relationship between ultrastructural features with the expression of connexin 43 in the uterine junction zone and pathogenesis of adenomyosis].
20940304 2010 Ubiquitin-independent proteasomal degradation of endoplasmic reticulum-localized connexin43 mediated by CIP75.
20934339 2011 Gap junction protein connexin43 (GJA1) in the human glaucomatous optic nerve head and retina.
20881238 2010 Connexin 43 hemichannels mediate the Ca2+ influx induced by extracellular alkalinization.
20878577 2010 [Connexin 43 expression in intraperitoneal free gastric cancer cells in patients with gastric cancer].
20876208 2011 Connexon-mediated cell adhesion drives microtissue self-assembly.
20803237 2010 Cell surface sialic acid inhibits Cx43 gap junction functions in constructed Hela cancer cells involving in sialylated N-cadherin.
20684953 2010 Androgen excess down-regulates connexin43 in a human granulosa cell line.
20668687 2010 Genotyping with a 198 mutation arrayed primer extension array for hereditary hearing loss: assessment of its diagnostic value for medical practice.
20651379 2010 Connexin 43, E-cadherin, beta-catenin and ZO-1 expression, and aberrant methylation of the connexin 43 gene in NSCLC.
20639392 2010 Genome-wide association analysis identifies multiple loci related to resting heart rate.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20606116 2010 Paradigm of genetic mosaicism and lone atrial fibrillation: physiological characterization of a connexin 43-deletion mutant identified from atrial tissue.
20593197 2010 Prospective variants screening of connexin genes in children with hearing impairment: genotype/phenotype correlation.
20530971 2010 High-level connexin expression in the human juxtaglomerular apparatus.
20512937 2010 Enhanced connexin 43 expression delays intra-mitotic duration and cell cycle traverse independently of gap junction channel function.
20512920 2010 The carboxy-terminal tail of connexin43 gap junction protein is sufficient to mediate cytoskeleton changes in human glioma cells.
20413811 2010 C-kit-positive multipolar cells in human penile erectile tissue: expression of connexin 43 and relation to trabecular smooth muscle cells.
20406988 2010 The tumor-suppressive function of Connexin43 in keratinocytes is mediated in part via interaction with caveolin-1.
20375327 2010 Immunolocalization of gap junction protein connexin43 (GJA1) in the human retina and optic nerve.
20373058 2011 Expression and significance of Cx43 and E-cadherin in gastric cancer and metastatic lymph nodes.
20347265 2010 MicroRNAs and target site screening reveals a pre-microRNA-30e variant associated with schizophrenia.
20346202 2010 Cardiac cell therapy with mesenchymal stem cell induces cardiac nerve sprouting, angiogenesis, and reduced connexin43-positive gap junctions, but concomitant electrical pacing increases connexin43-positive gap junctions in canine heart.
20233983 2010 Control of the proliferation of activated CD4+ T cells by connexins.
20167932 2010 Ultrastructure and regulation of lateralized connexin43 in the failing heart.
20137634 2009 [Expression and function of Cx32 and Cx43 junctions in medically intractable temporal lobe epilepsy in human].
20130915 2010 Novel mutations in the connexin43 (GJA1) and GJA1 pseudogene may contribute to nonsyndromic hearing loss.
20117462 2010 Rac1-induced connective tissue growth factor regulates connexin 43 and N-cadherin expression in atrial fibrillation.
20086016 2010 Pannexin1 and pannexin3 delivery, cell surface dynamics, and cytoskeletal interactions.
20038810 2010 Limited forward trafficking of connexin 43 reduces cell-cell coupling in stressed human and mouse myocardium.
19935872 2009 Asymmetric dimethylarginine damages connexin43-mediated endothelial gap junction intercellular communication.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910046 2010 Up-regulation of Cx43 expression and GJIC function in acute leukemia bone marrow stromal cells post-chemotherapy.
19908168 2010 Clinical significance of vascular endothelial growth factor and connexin43 for predicting pancreatic cancer clinicopathologic parameters.
19883623 2010 Connexin-based signaling in acute myelogenous leukemia (AML).
19864031 2010 Connexin 43 expression is associated with vascular activation in human radial artery.
19860828 2009 Tyrosine-dependent basolateral targeting of human connexin43-eYFP in Madin-Darby canine kidney cells can be disrupted by the oculodentodigital dysplasia mutation L90V.
19854014 2010 Genetic susceptibility to febrile seizures: case-control association studies.
19847613 2009 A case of oculodentodigital dysplasia syndrome with novel GJA1 gene mutation.
19820388 2009 Comparative evaluation of estrogen and progesterone receptor expression with connexins 26 and 43 in endometrial cancer.
19808665 2009 Characterization of the structure and intermolecular interactions between the connexin40 and connexin43 carboxyl-terminal and cytoplasmic loop domains.
19808103 Oculo-dento-digital dysplasia: lack of genotype-phenotype correlation for GJA1 mutations and usefulness of neuro-imaging.
19726320 2009 [Expression of nNOS, Pax3 and Cx43 proteins in early developing posterior horn of embryonic and fetal human spinal cord].
19716642 2009 Complex formation between calmodulin and a peptide from the intracellular loop of the gap junction protein connexin43: Molecular conformation and energetics of binding.
19710532 2009 TGF-beta1 mediates glucose-evoked up-regulation of connexin-43 cell-to-cell communication in HCD-cells.
19706598 2009 Matricellular protein CCN3 (NOV) regulates actin cytoskeleton reorganization.
19679555 2009 Overexpression of protease-activated receptor-1 contributes to melanoma metastasis via regulation of connexin 43.
19615768 2010 Mutation analysis of Connexon43 gene in Chinese patients with congenital heart defects.
19604543 2010 High levels of connexin 43 mRNA in high grade astrocytomas. Study of 32 cases with in situ hybridization.
19563063 2009 [Expression of connexin 43 in ovarian cancer and its relationship with chemoresistance].
19556520 2009 Novel pharmacophores of connexin43 based on the "RXP" series of Cx43-binding peptides.
19544087 2010 Connexin43 interacts with Caveolin-3 in the heart.
19490996 2009 Effect of high-frequency electromagnetic fields on trophoblastic connexins.
19460861 2009 Increased connexin 43 expression as a potential mediator of the neuroprotective activity of the corticotropin-releasing hormone.
19423654 2009 p54nrb is a transcriptional corepressor of the progesterone receptor that modulates transcription of the labor-associated gene, connexin 43 (Gja1).
19396169 2009 A large-scale genome-wide association study of Asian populations uncovers genetic factors influencing eight quantitative traits.
19338053 2009 GJA1 mutations, variants, and connexin 43 dysfunction as it relates to the oculodentodigital dysplasia phenotype.
19321666 2009 ERp29 restricts Connexin43 oligomerization in the endoplasmic reticulum.
19321193 2010 Differential expression of connexin 43 in human autoimmune thyroid disease.
19297523 2009 Conformational maturation and post-ER multisubunit assembly of gap junction proteins.
19297036 2010 Exclusion of Cx43 gene mutation as a major cause of criss-cross heart anomaly in man.
19174466 2009 Cx43 has distinct mobility within plasma-membrane domains, indicative of progressive formation of gap-junction plaques.
19084810 2008 Characterization of the molecular phenotype of two arrhythmogenic right ventricular cardiomyopathy (ARVC)-related plakophilin-2 (PKP2) mutations.
19056535 2008 Connexin 43 recruits E-cadherin expression and inhibits the malignant behaviour of lung cancer cells.
19027966 2009 Splice variant IVS2-2A>G in the SLC26A5 (Prestin) gene in five Estonian families with hearing loss.
19001515 2009 Melatonin synergizes with oxytocin to enhance contractility of human myometrial smooth muscle cells.
18988928 2008 Genetic analysis of presbycusis by arrayed primer extension.
18951659 2009 Perturbing plasma membrane hemichannels attenuates calcium signalling in cardiac cells and HeLa cells expressing connexins.
18946008 2008 Novel mutations in GJA1 cause oculodentodigital syndrome.
18839320 2008 Expressing connexin 43 in breast cancer cells reduces their metastasis to lungs.
18823947 2008 Functional consequences of overexpressing the gap junction Cx43 in the cardiogenic potential of pluripotent human embryonic stem cells.
18687515 2008 A pilot study of Connexin 43 (Cx43) in human bladder tissue in patients with idiopathic detrusor overactivity.
18675253 2008 Clathrin and Cx43 gap junction plaque endoexocytosis.
18662195 2009 Abnormal connexin43 in arrhythmogenic right ventricular cardiomyopathy caused by plakophilin-2 mutations.
18660473 2008 Expanding the neurologic phenotype of oculodentodigital dysplasia in a 4-generation Hispanic family.
18647409 2008 Connexin-43 upregulation in micrometastases and tumor vasculature and its role in tumor cell attachment to pulmonary endothelium.
18636092 2008 Domain-swapped dimerization of ZO-1 PDZ2 generates specific and regulatory connexin43-binding sites.
18600256 2008 Bystander effect in glioblastoma cells with a predominant cytoplasmic localization of connexin43.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18445604 2008 Activation of endothelial cells to pathological status by down-regulation of connexin43.
18435417 2008 Expression of astrocytic markers aquaporin 4 and connexin 43 is altered in brains of subjects with autism.
18425059 2009 Ocular manifestations in oculodentodigital dysplasia resulting from a heterozygous missense mutation (L113P) in GJA1 (connexin 43).
18412120 2008 Report of a black South African child with oculodentodigital dysplasia and a novel GJA1 gene mutation.
18405916 2008 Involvement of connexin 43 in angiotensin II-induced migration and proliferation of saphenous vein smooth muscle cells via the MAPK-AP-1 signaling pathway.
18396685 2007 [Decreased expression of Cx32 and Cx43 and their function of gap junction intercellular communication in gastric cancer].
18297686 2008 TNF-alpha represses connexin43 expression in HaCat keratinocytes via activation of JNK signaling.
18269311 2008 ODDD-linked Cx43 mutants reduce endogenous Cx43 expression and function in osteoblasts and inhibit late stage differentiation.
18267319 2008 Extracellular-loop peptide antibodies reveal a predominant hemichannel organization of connexins in polarized intestinal cells.
18193170 2008 Alterations in Cx43 and OB-cadherin affect breast cancer cell metastatic potential.
18162583 2008 Caveolin-1 and -2 interact with connexin43 and regulate gap junctional intercellular communication in keratinocytes.
18162455 Connexin 43 expression in human and mouse testes with impaired spermatogenesis.
18161618 2007 A new GJA1 (connexin 43) mutation causing oculodentodigital dysplasia associated to uncommon features.
18089569 2008 Closing the gap on autosomal dominant connexin-26 and connexin-43 mutants linked to human disease.
18085635 2008 Connexin 43 expression delineates two discrete pathways in the human atrioventricular junction.
18079109 2008 A novel connexin43-interacting protein, CIP75, which belongs to the UbL-UBA protein family, regulates the turnover of connexin43.
18068673 2008 Connexin 43 contributes to differentiation of retinal pigment epithelial cells via cyclic AMP signaling.
18056766 2008 Gap junction remodelling in human heart failure is associated with increased interaction of connexin43 with ZO-1.
18047584 2008 Ultraviolet A induced modulation of gap junctional intercellular communication by P38 MAPK activation in human keratinocytes.
17922338 Endothelial connexin 37, connexin 40, and connexin 43 respond uniquely to substrate and shear stress.
17901047 2007 Identification of the calmodulin binding domain of connexin 43.
17898133 2007 Intracellular calcium regulation of connexin43.
17895291 2007 Corticotropin-releasing hormone activates connexin 43 via activator protein-1 transcription factor in human myometrial smooth muscle cells.
17885214 2007 Enhanced transmural fiber rotation and connexin 43 heterogeneity are associated with an increased upper limit of vulnerability in a transgenic rabbit model of human hypertrophic cardiomyopathy.
17878326 2007 Cutting edge: Lack of evidence for connexin-43 expression in human epidermal Langerhans cells.
17760848 Zonula occludens-1 and connexin 43 expression in the failing human heart.
17708781 2007 [Connexin 43 expression and interacellular communicating function in acute leukemia bone marrow stroma cells].
17687502 2007 Some oculodentodigital dysplasia-associated Cx43 mutations cause increased hemichannel activity in addition to deficient gap junction channels.
17624368 2007 Angiotensin II and IGF-1 regulate connexin43 expression via ERK and p38 signaling pathways in vascular smooth muscle cells of coronary artery bypass conduits.
17572641 2007 Increased communication among nasal epithelial cells in air-liquid interface culture.
17551925 2007 Pressure induces loss of gap junction communication and redistribution of connexin 43 in astrocytes.
17541973 2007 The proteasome regulates the interaction between Cx43 and ZO-1.
17509830 2007 Oculodentodigital dysplasia with mandibular retrognathism and absence of syndactyly: a case report with a novel mutation in the connexin 43 gene.
17486593 2008 Endothelin-1 inhibits human osteoblastic cell differentiation: influence of connexin-43 expression level.
17420259 2007 Differential potency of dominant negative connexin43 mutants in oculodentodigital dysplasia.
17401374 2007 The muscle-specific microRNA miR-1 regulates cardiac arrhythmogenic potential by targeting GJA1 and KCNJ2.
17275998 2007 Connexin 43 expression promotes malignancy of HuH7 hepatocellular carcinoma cells via the inhibition of cell-cell communication.
17259707 2007 Identification of mutations in members of the connexin gene family as a cause of nonsyndromic deafness in Taiwan.
17189315 2007 Gating properties of heterotypic gap junction channels formed of connexins 40, 43, and 45.
17183550 2007 Connexin 43 is localized with actin in tenocytes.
17143533 2007 Combination of non-viral connexin 43 gene therapy and docetaxel inhibits the growth of human prostate cancer in mice.
17072341 2007 Gene expression response to cisplatin treatment in drug-sensitive and drug-resistant ovarian cancer cells.
16958087 2006 The TLR3 ligand polyI: C downregulates connexin 43 expression and function in astrocytes by a mechanism involving the NF-kappaB and PI3 kinase pathways.
16944923 2006 Interaction of zonula occludens-1 (ZO-1) with alpha-actinin-4: application of functional proteomics for identification of PDZ domain-associated proteins.
16891658 2006 Functional characterization of a GJA1 frameshift mutation causing oculodentodigital dysplasia and palmoplantar keratoderma.
16886200 2006 Enhanced connexin 43 immunoreactivity in penumbral areas in the human brain following ischemia.
16823880 2006 A potential novel mechanism involving connexin 43 gap junction for control of sertoli cell proliferation by thyroid hormones.
16820904 2006 Connexin 43 transfection in basaloid squamous cell carcinoma cells.
16820096 2006 Transition from preinvasive carcinoma in situ to seminoma is accompanied by a reduction of connexin 43 expression in Sertoli cells and germ cells.
16816024 2006 A nonsense mutation in the first transmembrane domain of connexin 43 underlies autosomal recessive oculodentodigital syndrome.
16813608 2006 Clinical and genetic variability of oculodentodigital dysplasia.
16790700 2006 Somatic mutations in the connexin 40 gene (GJA5) in atrial fibrillation.
16741927 2006 Leukemogenic AML1-ETO fusion protein upregulates expression of connexin 43: the role in AML 1-ETO-induced growth arrest in leukemic cells.
16709485 A novel GJA 1 mutation in oculo-dento-digital dysplasia with curly hair and hyperkeratosis.
16684925 2006 Glucose-evoked alterations in connexin43-mediated cell-to-cell communication in human collecting duct: a possible role in diabetic nephropathy.
16677845 2006 Connexin43: emerging role in erectile function.
16675599 2006 Downregulation of connexin 43 expression by high glucose induces senescence in glomerular mesangial cells.
16674815 2006 Prolonged labour associated with lower expression of syndecan 3 and connexin 43 in human uterine tissue.
16647893 2006 Loss of communication in ovarian cancer.
16638984 2006 Structural assessment of PITX2, FOXC1, CYP1B1, and GJA1 genes in patients with Axenfeld-Rieger syndrome with developmental glaucoma.
16580773 2007 Connexin expression in mouse lung tumor.
16480955 2006 Reduced atrial connexin43 expression after pediatric heart surgery.
16442184 2006 Up-regulation of connexin43 correlates with increased synthetic activity and enhanced contractile differentiation in TGF-beta-treated human aortic smooth muscle cells.
16424398 2006 Gap junction protein connexin 43 serves as a negative marker for a stem cell-containing population of human limbal epithelial cells.
16407179 2006 Mutation of a conserved threonine in the third transmembrane helix of alpha- and beta-connexins creates a dominant-negative closed gap junction channel.
16378922 Novel GJA1 mutations in patients with oculo-dento-digital dysplasia (ODDD).
16361362 2006 Flow regulates intercellular communication in HAEC by assembling functional Cx40 and Cx37 gap junctional channels.
16319124 2006 Modulation of connexin43 alters expression of osteoblastic differentiation markers.
16222672 2005 Letter to the editor: Novel GJA1 mutation in oculodentodigital dysplasia.
16219735 2005 A novel mutation in the GJA1 gene in a family with oculodentodigital dysplasia.
16112082 2005 Molecular cloning and functional analysis of a novel Cx43 partner protein CIP150.
16103109 2005 New possible roles for aquaporin-4 in astrocytes: cell cytoskeleton and functional relationship with connexin43.
16010294 2005 The expression of connexin 43 in children with Tetralogy of Fallot.
15987459 2005 Connexin 43 mediated gap junctional communication enhances breast tumor cell diapedesis in culture.
15979566 2005 Connexin43 with a cytoplasmic loop deletion inhibits the function of several connexins.
15978203 2005 Mutations of connexin43 in fetuses with congenital heart malformations.
15948121 2005 The phosphorylated form of connexin43 is up-regulated in breast hyperplasias and carcinomas and in their neoformed capillaries.
15944608 2005 Increased connexin43 expression in human saphenous veins in culture is associated with intimal hyperplasia.
15919068 2005 Connexin 43 in cardiomyocyte mitochondria and its increase by ischemic preconditioning.
15870276 2005 Restoration of functional gap junctions through internal ribosome entry site-dependent synthesis of endogenous connexins in density-inhibited cancer cells.
15817491 2005 Defining a minimal motif required to prevent connexin oligomerization in the endoplasmic reticulum.
15757815 Bigenic connexin mutations in a patient with hidrotic ectodermal dysplasia.
15709751 2005 Novel rab GAP-like protein, CIP85, interacts with connexin43 and induces its degradation.
15704645 2004 Expression of connexins 26, 32 and 43 in the human colon--an immunohistochemical study.
15637728 2005 A novel GJA1 mutation causes oculodentodigital dysplasia without syndactyly.
15605363 2005 Cellular sublocalization of Cx43 and the establishment of functional coupling in IMR-32 neuroblastoma cells.
15576650 2005 Connexin 43 downregulation and dephosphorylation in nonischemic heart failure is associated with enhanced colocalized protein phosphatase type 2A.
15551259 2005 A 2-bp deletion in the GJA1 gene is associated with oculo-dento-digital dysplasia with palmoplantar keratoderma.
15534005 2004 Protein kinase C spatially and temporally regulates gap junctional communication during human wound repair via phosphorylation of connexin43 on serine368.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15338868 2004 [A study of the relationship between the expression of connexin43, E-cadherin and biological behaviors of human laryngeal cancer].
15334670 2004 Are gap junction gene connexins 26, 32 and 43 of prognostic values in hepatocellular carcinoma? A prospective study.
15213231 2004 CCN3 (NOV) interacts with connexin43 in C6 glioma cells: possible mechanism of connexin-mediated growth suppression.
15181016 2004 Connexin43 interacts with NOV: a possible mechanism for negative regulation of cell growth in choriocarcinoma cells.
15140236 2004 Connexins 26, 30, and 43: differences among spontaneous, chronic, and accelerated human wound healing.
15108203 2004 Novel Connexin 43 (GJA1) mutation causes oculo-dento-digital dysplasia with curly hair.
15044680 2004 Basic mechanisms of cardiac impulse propagation and associated arrhythmias.
14974090 2004 A homozygous GJA1 gene mutation causes a Hallermann-Streiff/ODDD spectrum phenotype.
14766937 2004 Human mesenchymal stem cells make cardiac connexins and form functional gap junctions.
14729836 2004 Expression of Gja1 correlates with the phenotype observed in oculodentodigital syndrome/type III syndactyly.
14713573 2003 Low dose ionizing radiation-induced activation of connexin 43 expression.
14702389 2004 Phosphorylation of serine 262 in the gap junction protein connexin-43 regulates DNA synthesis in cell-cell contact forming cardiomyocytes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14681024 Functioning of cx43 hemichannels demonstrated by single channel properties.
14667880 2003 Significance of mRNA levels of connexin37, connexin43, and connexin45 in luteinized granulosa cells of controlled hyperstimulated follicles.
14639017 2003 Correlation of connexin43 expression and late ventricular potentials in nonischemic dilated cardiomyopathy.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14519646 2003 The correlation between aberrant connexin 43 mRNA expression induced by promoter methylation and nodal micrometastasis in non-small cell lung cancer.
13130072 2003 Gating and regulation of connexin 43 (Cx43) hemichannels.
12907686 2003 Endothelin-1 decreases gap junctional intercellular communication by inducing phosphorylation of connexin 43 in human ovarian carcinoma cells.
12881039 BMP regulation of the mouse connexin43 promoter in osteoblastic cells and embryos.
12861055 2003 Mutations in the second extracellular region of connexin 43 prevent localization to the plasma membrane, but do not affect its ability to suppress cell growth.
12840075 2003 Involvement of connexin 43 in human trophoblast cell fusion and differentiation.
12804600 2003 Ca2+ -dependent interaction of S100A1 with the sarcoplasmic reticulum Ca2+ -ATPase2a and phospholamban in the human heart.
12767974 2003 Lysosomal and proteasomal degradation play distinct roles in the life cycle of Cx43 in gap junctional intercellular communication-deficient and -competent breast tumor cells.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12730291 2003 A tyrosine-based sorting signal is involved in connexin43 stability and gap junction turnover.
12717835 2003 Signal transduction of gap junctional genes, connexin32, connexin43 in human hepatocarcinogenesis.
12644583 2003 Unexpected induction of the human connexin 43 promoter by the ras signaling pathway is mediated by a novel putative promoter sequence.
12637502 2003 Regulation of epidermal growth factor-induced connexin 43 gap junction communication by big mitogen-activated protein kinase1/ERK5 but not ERK1/2 kinase activation.
12619876 2003 Gap junction remodeling and altered connexin43 expression in the failing human heart.
12619863 2003 The carboxy-tail of connexin-43 localizes to the nucleus and inhibits cell growth.
12506110 2003 Defective activation of c-Src in cystic fibrosis airway epithelial cells results in loss of tumor necrosis factor-alpha-induced gap junction regulation.
12489165 2002 In vivo and in vitro expression of connexin 43 in human teeth.
12484567 2002 Immunohistochemical and ultrastructural study of gap junction proteins connexin26 and 43 in human arachnoid villi and meningeal tumors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12457340 2003 Connexin 43 (GJA1) mutations cause the pleiotropic phenotype of oculodentodigital dysplasia.
12452056 2002 [Expression of connexin43 and connexin45 in nasopharyngeal carcinoma].
12417300 2002 Identification and functional analysis of novel phosphorylation sites in Cx43 in rat primary granulosa cells.
12397213 2002 Connexin expression and gap junctional intercellular communication in human first trimester trophoblast.
12270943 2002 Casein kinase 1 regulates connexin-43 gap junction assembly.
12205082 2002 Impaired trafficking of connexins in androgen-independent human prostate cancer cell lines and its mitigation by alpha-catenin.
12203365 2002 Inducible expression of the gap junction protein connexin43 decreases the neoplastic potential of HT-1080 human fibrosarcoma cells in vitro and in vivo.
12149451 2002 Dynamic trafficking and delivery of connexons to the plasma membrane and accretion to gap junctions in living cells.
12064631 2001 Aggregated DsRed-tagged Cx43 and over-expressed Cx43 are targeted to lysosomes in human breast cancer cells.
12064622 2001 Bisphosphonate-induced, hemichannel-mediated, anti-apoptosis through the Src/ERK pathway: a gap junction-independent action of connexin43.
12064615 2001 Comparison of connexin 43, 40 and 45 expression patterns in the developing human and mouse hearts.
12042301 2002 Retroviral delivery of connexin genes to human breast tumor cells inhibits in vivo tumor growth by a mechanism that is independent of significant gap junctional intercellular communication.
11980479 2002 Connexin family members target to lipid raft domains and interact with caveolin-1.
11815667 2002 Conductance and permeability of the residual state of connexin43 gap junction channels.
11741942 2002 Transduction of cell survival signals by connexin-43 hemichannels.
11741837 2001 Mutations in GJA1 (connexin 43) are associated with non-syndromic autosomal recessive deafness.
11739633 2001 Multimeric connexin interactions prior to the trans-Golgi network.
11557558 2001 Gap junction channels formed by coexpressed connexin40 and connexin43.
11514593 2001 v-Src phosphorylation of connexin 43 on Tyr247 and Tyr265 disrupts gap junctional communication.
11470490 2001 Identification of connexin43 (alpha1) gap junction gene mutations in patients with hypoplastic left heart syndrome by denaturing gradient gel electrophoresis (DGGE).
11273731 2001 Protein kinase C-alpha and -epsilon modulate connexin-43 phosphorylation in human heart.
11146471 2000 Mapping of the autosomal recessive (AR) craniometaphyseal dysplasia locus to chromosome region 6q21-22 and confirmation of genetic heterogeneity for mild AR spondylocostal dysplasia.
11124251 2001 Interaction of c-Src with gap junction protein connexin-43. Role in the regulation of cell-cell communication.
11035005 2001 c-Src regulates the interaction between connexin-43 and ZO-1 in cardiac myocytes.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10871288 2000 Phosphorylation of connexin43 on serine368 by protein kinase C regulates gap junctional communication.
10792506 2000 Intercellular communication in the immune system: differential expression of connexin40 and 43, and perturbation of gap junction channel functions in peripheral blood and tonsil human lymphocyte subpopulations.
10764404 2000 Connexin expression and turnover : implications for cardiac excitability.
10679481 2000 The epsilon subtype of protein kinase C is required for cardiomyocyte connexin-43 phosphorylation.
10581143 1999 Sporadic cases of dilated cardiomyopathies associated with atrioventricular conduction defects are not linked to mutation within the connexins 40 and 43 genes.
10331943 1999 Linkage analysis narrows the critical region for oculodentodigital dysplasia to chromosome 6q22-q23.
9707407 1998 The gap junction protein connexin43 interacts with the second PDZ domain of the zona occludens-1 protein.
9535909 1998 Regulation of connexin-43 gap junctional intercellular communication by mitogen-activated protein kinase.
9535905 1998 Identification of a domain on the beta-subunit of the rod cGMP-gated cation channel that mediates inhibition by calcium-calmodulin.
9443444 1998 connexin43 gene mutations and heterotaxy.
9430691 1998 Intercellular calcium signaling via gap junction in connexin-43-transfected cells.
9278444 1997 Tyrosine phosphorylation of connexin 43 by v-Src is mediated by SH2 and SH3 domain interactions.
9155619 1997 Absence of mutations in the regulatory domain of the gap junction protein connexin 43 in patients with visceroatrial heterotaxy.
8873667 1996 Failure to detect connexin43 mutations in 38 cases of sporadic and familial heterotaxy.
8798588 1996 Activation of protein kinase C in human uterine smooth muscle induces connexin-43 gene transcription through an AP-1 site in the promoter sequence.
8631994 1996 Characterization of the mitogen-activated protein kinase phosphorylation sites on the connexin-43 gap junction protein.
8389684 1993 Human connexin43 gene locus, GJA1, sublocalized to band 6q21-->q23.2.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8028021 1994 Functional analysis of the connexin43 gene promoter in vivo and in vitro.
7715640 1995 Mutations of the Connexin43 gap-junction gene in patients with heart malformations and defects of laterality.
1850831 1991 Functional analysis of human cardiac gap junction channel mutants.
1696265 1990 Molecular characterization and functional expression of the human cardiac gap junction channel.
1646158 1991 The human connexin gene family of gap junction proteins: distinct chromosomal locations but similar structures.