Property Summary

NCBI Gene PubMed Count 21
PubMed Score 178.10
PubTator Score 38.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Protein-protein Interaction (8)

Gene RIF (10)

PMID Text
24716791 GGPPS1 may play a critical role during the development of HCC from cirrhosis and is of clinical significance for predicting biological character of HCC.
23478574 Egr-1 most likely does not induce the constitutive activation of Erk1/2 through its target gene GGPS1.
21321112 the Egr-1/GGPPS/Erk1/2 pathway is responsible for insulin resistance during hyperinsulinism
21224049 these results reveal a new EGR-1/GGPPS/MAPK signaling pathway that controls cigarette smoke-induced pulmonary inflammation.
20191015 Study suggested that GGPS1 -8188A ins/del polymorphism may confer susceptibility to femoral neck BMD response to bisphosphonate therapy in Korean women.
20191015 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17646172 results indicate that the active form of GGPS in the solution is an octamer rather than hexamer or dimer
17536018 Farnesyltranstransferase mutations are associated with lonafarnib resistance
16698791 crystal structure; it reveals that three dimers join together to form a propeller-bladed hexameric molecule with a mass of approximately 200 kDa
8419360 Evidence for a non-membrane bound isoform of geranylgeranyl diphosphate synthase 1 in rat.

AA Sequence

MEKTQETVQRILLEPYKYLLQLPGKQVRTKLSQAFNHWLKVPEDKLQIIIEVTEMLHNASLLIDDIEDNS      1 - 70
KLRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTLDHPDAVKLFTRQLLELHQGQGLDIYWRDNYTCPT     71 - 140
EEEYKAMVLQKTGGLFGLAVGLMQLFSDYKEDLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTE    141 - 210
GKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGG    211 - 280
NPELVALVKHLSKMFKEENE                                                      281 - 300
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24716791 2014 GGPPS1 predicts the biological character of hepatocellular carcinoma in patients with cirrhosis.
23478574 2013 Egr-1 enhances drug resistance of breast cancer by modulating MDR1 expression in a GGPPS-independent manner.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21321112 2011 An early response transcription factor, Egr-1, enhances insulin resistance in type 2 diabetes with chronic hyperinsulinism.
21269460 2011 Initial characterization of the human central proteome.
21224049 2011 Cigarette smoke-induced pulmonary inflammatory responses are mediated by EGR-1/GGPPS/MAPK signaling.
20191015 2010 Genetic polymorphism of geranylgeranyl diphosphate synthase (GGSP1) predicts bone density response to bisphosphonate therapy in Korean women.
18726356 2000 cDNA cloning, chromosome mapping and expression characterization of human geranylgeranyl pyrophosphate synthase.
17646172 2007 Human geranylgeranyl diphosphate synthase is an octamer in solution.
17536018 2007 Farnesyl transferase inhibitor resistance probed by target mutagenesis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16698791 2006 The crystal structure of human geranylgeranyl pyrophosphate synthase reveals a novel hexameric arrangement and inhibitory product binding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446740 2002 Missense mutation in the tubulin-specific chaperone E (Tbce) gene in the mouse mutant progressive motor neuronopathy, a model of human motoneuron disease.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10101267 1999 Identification of the GGPS1 genes encoding geranylgeranyl diphosphate synthases from mouse and human.
10026212 1999 Human geranylgeranyl diphosphate synthase. cDNA cloning and expression.
9741684 1998 Human geranylgeranyl diphosphate synthase: isolation of the cDNA, chromosomal mapping and tissue expression.
8419360 1993 Distribution of prenyltransferases in rat tissues. Evidence for a cytosolic all-trans-geranylgeranyl diphosphate synthase.