Property Summary

NCBI Gene PubMed Count 7
PubMed Score 15.03
PubTator Score 4.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.600 9.1e-04
posterior fossa group A ependymoma 1.100 3.1e-06

Gene RIF (1)

AA Sequence

MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAV      1 - 70
DERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSE     71 - 140
GPHGLRYNPRENR                                                             141 - 153
//

Text Mined References (9)

PMID Year Title