Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.75
PubTator Score 2.06

Knowledge Summary


No data available


  Differential Expression (8)

Disease log2 FC p
psoriasis 1.300 2.9e-03
osteosarcoma -1.193 1.6e-06
glioblastoma -1.300 6.0e-05
medulloblastoma, large-cell -1.100 2.8e-03
pancreatic ductal adenocarcinoma liver m... -1.037 4.5e-03
adult high grade glioma -1.400 7.8e-04
subependymal giant cell astrocytoma -1.279 1.9e-02
spina bifida -1.340 4.0e-02

Gene RIF (1)

24064143 Variation in the GFOD2 gene contributes to the genetic basis for a differential response to a cholesterol- or lipid-lowering diet.

AA Sequence

IKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNL                                       351 - 385

Text Mined References (11)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24064143 2013 Effect of a GFOD2 variant on responses in total and LDL cholesterol in Mexican subjects with hypercholesterolemia after soy protein and soluble fiber supplementation.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.