Property Summary

NCBI Gene PubMed Count 28
PubMed Score 20.38
PubTator Score 16.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
group 3 medulloblastoma 2254 2.6e-04
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Muscular atrophy 67 4.871 2.4
Spinal muscular atrophy 24 3.654 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.100 2.6e-04

Gene RIF (13)

PMID Text
26069323 Gemin5 is dispensable for snRNA identification and snRNP assembly.
25911097 This work both reveals a new autoregulatory pathway governing SMN expression, and identifies a new mechanism through which SMN can modulate specific mRNA expression via Gemin5.
25631074 Cellular biotinylated gem-associated protein 5 (GEMIN5) protein is incorporated into HIV-1 Gag virus-like particles
24598255 The C-terminal region of Gemin5 bears two non-canonical bipartite RNA-binding sites.
20513430 The Gemin5's function in delivering pre-snRNAs as substrates for Sm core assembly and processing.
19750007 gemin5 has a role as a novel cap-binding protein and WD repeat domains are involved in m(7)G recognition
19377484 The entire WD repeat domain, comprising 13 WD motifs, is both necessary and sufficient for sequence-specific, high-affinity binding of Gemin5 to its RNA targets.
18245461 The data provide the first demonstration that alterations in the expression of Gemin5, a spliceosome protein, can effect both specific splicing events and tumor cell motility.
17640873 Gemin5-containing subunits bind small nuclear RNA independently of the SMN complex and without a requirement for exogenous ATP
17640370 Absence of GEMIN5 from SMN complexes in nuclear Cajal bodies is demonstrated.
17541429 Gemin5 functions as a scaffold protein for the ASK1-JNK1 signaling module and thereby potentiates ASK1-mediated signaling events.
16857593 Gemin5 is the snRNA binding protein of the SMN complex, binding directly and specifically to the unique features of snRNAs and is the factor that allows the SMN complex to distinguish snRNAs from other cellular RNAs for snRNP biogenesis
11714716 we report the identification of an additional component of the SMN complex, a novel WD repeat protein termed Gemin5. Gemin5 binds SMN directly and is a component of the SMN complex

AA Sequence

MGQEPRTLPPSPNWYCARCSDAVPGGLFGFAARTSVFLVRVGPGAGESPGTPPFRVIGELVGHTERVSGF      1 - 70
TFSHHPGQYNLCATSSDDGTVKIWDVETKTVVTEHALHQHTISTLHWSPRVKDLIVSGDEKGVVFCYWFN     71 - 140
RNDSQHLFIEPRTIFCLTCSPHHEDLVAIGYKDGIVVIIDISKKGEVIHRLRGHDDEIHSIAWCPLPGED    141 - 210
CLSINQEETSEEAEITNGNAVAQAPVTKGCYLATGSKDQTIRIWSCSRGRGVMILKLPFLKRRGGGIDPT    211 - 280
VKERLWLTLHWPSNQPTQLVSSCFGGELLQWDLTQSWRRKYTLFSASSEGQNHSRIVFNLCPLQTEDDKQ    281 - 350
LLLSTSMDRDVKCWDIATLECSWTLPSLGGFAYSLAFSSVDIGSLAIGVGDGMIRVWNTLSIKNNYDVKN    351 - 420
FWQGVKSKVTALCWHPTKEGCLAFGTDDGKVGLYDTYSNKPPQISSTYHKKTVYTLAWGPPVPPMSLGGE    421 - 490
GDRPSLALYSCGGEGIVLQHNPWKLSGEAFDINKLIRDTNSIKYKLPVHTEISWKADGKIMALGNEDGSI    491 - 560
EIFQIPNLKLICTIQQHHKLVNTISWHHEHGSQPELSYLMASGSNNAVIYVHNLKTVIESSPESPVTITE    561 - 630
PYRTLSGHTAKITSVAWSPHHDGRLVSASYDGTAQVWDALREEPLCNFRGHRGRLLCVAWSPLDPDCIYS    631 - 700
GADDFCVHKWLTSMQDHSRPPQGKKSIELEKKRLSQPKAKPKKKKKPTLRTPVKLESIDGNEEESMKENS    701 - 770
GPVENGVSDQEGEEQAREPELPCGLAPAVSREPVICTPVSSGFEKSKVTINNKVILLKKEPPKEKPETLI    771 - 840
KKRKARSLLPLSTSLDHRSKEELHQDCLVLATAKHSRELNEDVSADVEERFHLGLFTDRATLYRMIDIEG    841 - 910
KGHLENGHPELFHQLMLWKGDLKGVLQTAAERGELTDNLVAMAPAAGYHVWLWAVEAFAKQLCFQDQYVK    911 - 980
AASHLLSIHKVYEAVELLKSNHFYREAIAIAKARLRPEDPVLKDLYLSWGTVLERDGHYAVAAKCYLGAT    981 - 1050
CAYDAAKVLAKKGDAASLRTAAELAAIVGEDELSASLALRCAQELLLANNWVGAQEALQLHESLQGQRLV   1051 - 1120
FCLLELLSRHLEEKQLSEGKSSSSYHTWNTGTEGPFVERVTAVWKSIFSLDTPEQYQEAFQKLQNIKYPS   1121 - 1190
ATNNTPAKQLLLHICHDLTLAVLSQQMASWDEAVQALLRAVVRSYDSGSFTIMQEVYSAFLPDGCDHLRD   1191 - 1260
KLGDHQSPATPAFKSLEAFFLYGRLYEFWWSLSRPCPNSSVWVRAGHRTLSVEPSQQLDTASTEETDPET   1261 - 1330
SQPEPNRPSELDLRLTEEGERMLSTFKELFSEKHASLQNSQRTVAEVQETLAEMIRQHQKSQLCKSTANG   1331 - 1400
PDKNEPEVEAEQPLCSSQSQCKEEKNEPLSLPELTKRLTEANQRMAKFPESIKAWPFPDVLECCLVLLLI   1401 - 1470
RSHFPGCLAQEMQQQAQELLQKYGNTKTYRRHCQTFCM                                   1471 - 1508
//

Text Mined References (36)

PMID Year Title
26069323 2015 Reconstitution of the human U snRNP assembly machinery reveals stepwise Sm protein organization.
25911097 2015 Gemin5 Binds to the Survival Motor Neuron mRNA to Regulate SMN Expression.
24598255 2014 Identification of novel non-canonical RNA-binding sites in Gemin5 involved in internal initiation of translation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20513430 2010 Gemin5 delivers snRNA precursors to the SMN complex for snRNP biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19750007 2009 Identification of gemin5 as a novel 7-methylguanosine cap-binding protein.
19377484 2009 Gemin5-snRNA interaction reveals an RNA binding function for WD repeat domains.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18245461 2008 Alterations in Gemin5 expression contribute to alternative mRNA splicing patterns and tumor cell motility.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17640873 2007 SMN-independent subunits of the SMN complex. Identification of a small nuclear ribonucleoprotein assembly intermediate.
17640370 2007 Absence of gemin5 from SMN complexes in nuclear Cajal bodies.
17541429 2007 Positive regulation of ASK1-mediated c-Jun NH(2)-terminal kinase signaling pathway by the WD-repeat protein Gemin5.
17381311 2006 The SMN complex: an assembly machine for RNPs.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16857593 2006 The Gemin5 protein of the SMN complex identifies snRNAs.
16739988 2006 Quantitative proteomics identifies Gemin5, a scaffolding protein involved in ribonucleoprotein assembly, as a novel partner for eukaryotic initiation factor 4E.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15130578 2004 Why do cells need an assembly machine for RNA-protein complexes?
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12065586 2002 Identification and characterization of Gemin7, a novel component of the survival of motor neuron complex.
11714716 2002 Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins.
10531003 1999 Newly assembled snRNPs associate with coiled bodies before speckles, suggesting a nuclear snRNP maturation pathway.