Property Summary

NCBI Gene PubMed Count 19
PubMed Score 102.63
PubTator Score 20.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Gene RIF (11)

AA Sequence

MPPPQQGPCGHHLLLLLALLLPSLPLTRAPVPPGPAAALLQALGLRDEPQGAPRLRPVPPVMWRLFRRRD      1 - 70
PQETRSGSRRTSPGVTLQPCHVEELGVAGNIVRHIPDRGAPTRASEPASAAGHCPEWTVVFDLSAVEPAE     71 - 140
RPSRARLELRFAAAAAAAPEGGWELSVAQAGQGAGADPGPVLLRQLVPALGPPVRAELLGAAWARNASWP    141 - 210
RSLRLALALRPRAPAACARLAEASLLLVTLDPRLCHPLARPRRDAEPVLGGGPGGACRARRLYVSFREVG    211 - 280
WHRWVIAPRGFLANYCQGQCALPVALSGSGGPPALNHAVLRALMHAAAPGAADLPCCVPARLSPISVLFF    281 - 350
DNSDNVVLRQYEDMVVDECGCR                                                    351 - 372
//

Text Mined References (19)

PMID Year Title