Property Summary

NCBI Gene PubMed Count 25
PubMed Score 69.93
PubTator Score 35.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 2.800 2.9e-06
osteosarcoma -4.619 2.2e-08
cystic fibrosis 1.864 9.5e-05
atypical teratoid/rhabdoid tumor 2.000 9.3e-04
tuberculosis 2.100 4.7e-06
colon cancer -3.000 1.4e-05
lung cancer -2.100 1.8e-05
active Crohn's disease -1.491 3.3e-02
ulcerative colitis -2.000 1.5e-02
pilocytic astrocytoma 1.400 3.1e-03
sonic hedgehog group medulloblastoma 2.800 2.3e-05
Breast cancer -1.100 1.3e-02
acute myeloid leukemia -1.400 1.8e-02
pituitary cancer -1.500 1.1e-02

Protein-protein Interaction (7)

Gene RIF (9)

PMID Text
26678556 GCNT2 expression is closely associated with invasive potential of prostate cancer.
25750292 Hypomethylation of the GCNT2 variant 2 reflected lymph node metastasis of colorectal cancer in the tumor and normal tissues.
21761136 An Alu repeat-mediated genomic GCNT2 deletion underlies congenital cataracts and adult i blood group
21750175 Results show involvement of GCNT2 in EMT and TGF-beta signaling, and further glycosylation modification of E-cadherin by GCNT2, are the underlying integrative mechanisms for breast cancer metastasis.
21541272 In the family with the "ii" blood group a novel GCNT2 mutation was found in the cataract patients.
17855628 role of C/EBPalpha in the induction of the IGnTC gene as well as in I antigen expression
15882971 Observational study of gene-disease association. (HuGE Navigator)
15161861 A nonsense mutation in the GCNT2 gene isoforms is associated with autosomal recessive congenital cataract in four distantly related Arab families from Israel.
12244172 The I carbohydrate antigen interacts simultaneously with the entire hydrophobic patch in framework region 1 and with the outside surface of Ig heavy chain complementarity-determining region 3, leaving most of the site available for binding other antigens.

AA Sequence

MMGSWKHCLFSASLISALIFVFVYNTELWENKRFLRAALSNASLLAEACHQIFEGKVFYPTENALKTTLD      1 - 70
EATCYEYMVRSHYVTETLSEEEAGFPLAYTVTIHKDFGTFERLFRAIYMPQNVYCVHLDQKATDAFKGAV     71 - 140
KQLLSCFPNAFLASKKESVVYGGISRLQADLNCLEDLVASEVPWKYVINTCGQDFPLKTNREIVQYLKGF    141 - 210
KGKNITPGVLPPDHAVGRTKYVHQELLNHKNSYVIKTTKLKTPPPHDMVIYFGTAYVALTRDFANFVLQD    211 - 280
QLALDLLSWSKDTYSPDEHFWVTLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYG    281 - 350
NGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF                      351 - 402
//

Text Mined References (27)

PMID Year Title
26678556 2016 I-branching N-acetylglucosaminyltransferase regulates prostate cancer invasiveness by enhancing ?5?1 integrin signaling.
25750292 2015 Aberrant methylation of GCNT2 is tightly related to lymph node metastasis of primary CRC.
21761136 2012 An Alu repeat-mediated genomic GCNT2 deletion underlies congenital cataracts and adult i blood group.
21750175 2011 Engagement of I-branching {beta}-1, 6-N-acetylglucosaminyltransferase 2 in breast cancer metastasis and TGF-{beta} signaling.
21541272 2011 Hematologic biomarkers in childhood cataracts.
17855628 2007 I branching formation in erythroid differentiation is regulated by transcription factor C/EBPalpha.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15882971 2005 An A/G polymorphism of core 2 branching enzyme gene is associated with prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15161861 2004 A nonsense mutation in the glucosaminyl (N-acetyl) transferase 2 gene (GCNT2): association with autosomal recessive congenital cataracts.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14672974 2004 Multiple variable first exons: a mechanism for cell- and tissue-specific gene regulation.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12468428 2003 A novel I-branching beta-1,6-N-acetylglucosaminyltransferase involved in human blood group I antigen expression.
12424189 2003 The molecular genetics of the human I locus and molecular background explain the partial association of the adult i phenotype with congenital cataracts.
12244172 2002 Evidence for involvement of a hydrophobic patch in framework region 1 of human V4-34-encoded Igs in recognition of the red blood cell I antigen.
11739194 2001 Molecular basis of the adult i phenotype and the gene responsible for the expression of the human blood group I antigen.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
9915862 1999 Molecular cloning and expression of a novel beta-1, 6-N-acetylglucosaminyltransferase that forms core 2, core 4, and I branches.
9417921 1997 Fine mapping of 39 ESTs on human chromosome 6p23-p25.
9405606 1997 Expression cloning of cDNA encoding a human beta-1,3-N-acetylglucosaminyltransferase that is essential for poly-N-acetyllactosamine synthesis.
9134435 1997 Expression of the large I antigen forming beta-1,6-N-acetylglucosaminyltransferase in various tissues of adult mice.
8449405 1993 Expression of the developmental I antigen by a cloned human cDNA encoding a member of a beta-1,6-N-acetylglucosaminyltransferase gene family.
7579796 1995 Genomic organization of core 2 and I branching beta-1,6-N-acetylglucosaminyltransferases. Implication for evolution of the beta-1,6-N-acetylglucosaminyltransferase gene family.
2791656 1989 Report of the committee on linkage and gene order.
438154 1979 Developmental change and genetic defect in the carbohydrate structure of band 3 glycoprotein of human erythrocyte membrane.