Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.11
PubTator Score 12.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
group 3 medulloblastoma 4104 2.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 3.0
Disease Target Count Z-score Confidence
Secretory diarrhea 10 3.506 1.8
Oropharynx cancer 9 3.055 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.200 2.1e-04

Gene RIF (3)

AA Sequence

MEKFGMNFGGGPSKKDLLETIETQKKQLLQYQARLKDVVRAYKSLLKEKEALEASIKVLSVSHEADVGLA      1 - 70
GVQLPGLTFPDSVDDRCSTHSEDSTGTATSLDTAASLTSTKGEFGVEDDRPARGPPPPKSEEASWSESGV     71 - 140
SSSSGDGPFAGGEVDKRLHQLKTQLATLTSSLATVTQEKSRMEASYLADKKKMKQDLEDASNKAEEERAR    141 - 210
LEGELKGLQEQIAETKARLITQQHDRAQEQSDHALMLRELQKLLQEERTQRQDLELRLEETREALAGRAY    211 - 280
AAEQMEGFELQTKQLTREVEELKSELQAIRDEKNQPDPRLQELQEEAARLKSHFQAQLQQEMRKTALAED    281 - 350
QLRQQSQVEEQRVAALENQISEVSELLGTYEKAKQKDQLAIQKLKERILQLDLENKTLALAASSRSPLDS    351 - 420
HGEESSLDVNVLKDKMEKLKRLLQVAARKSQVTLDVEKLCDLEIMPSSEAADGEKATALYYQQELKQLKE    421 - 490
EFERYKMRAQVVLKSKNTKDGNLGKELEAAQEQLAELKEKYISLRLSCEELEHQHQQEADDWKQELARLQ    491 - 560
QLHRQELERCQLDFRDRTLKLEEELHKQRDRALAVLTEKDLELEQLRSVALASGLPGRRSPVGGGGPGDP    561 - 630
ADTSSSDSLTQALQLAAANEPTFFLYAEQLARKEVEITSLRKQKHRLEVEVHQLQDRLLEEGERHREEVA    631 - 700
ALQSHIEKNIRDQSREGANLEYLKNIIYRFLTLPDSLGRQQTLTAILTILHFSPEEKQVIMRLPTSASWW    701 - 770
PSGKR                                                                     771 - 775
//

Text Mined References (16)

PMID Year Title