Property Summary

NCBI Gene PubMed Count 24
PubMed Score 93.94
PubTator Score 59.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
gastric cancer 1.100 2.1e-03
hepatocellular carcinoma 1.200 2.0e-05
pancreatic cancer 1.700 2.4e-04
interstitial lung disease -1.200 3.2e-02
esophageal adenocarcinoma 1.100 2.0e-02
osteosarcoma -2.241 1.0e-02
cystic fibrosis 2.887 1.9e-07
medulloblastoma, large-cell -1.600 7.1e-04
tuberculosis 1.500 1.1e-03
non-small cell lung cancer -1.426 7.5e-19
lung cancer -1.900 4.9e-05
diabetes mellitus -1.300 3.0e-02
pancreatic carcinoma 1.700 2.4e-04
Pick disease -1.100 8.2e-03
progressive supranuclear palsy -1.300 3.2e-02
ovarian cancer -1.900 4.9e-07
dermatomyositis 1.600 5.9e-03

Gene RIF (9)

PMID Text
26648480 Results indicate that heterodimerization of GCA and TLR9 is important for TLR9-mediated downstream signaling and might serve to fine tune processes against viral infection.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19156166 IFIH1-GCA-KCNH7 locus is not associated with genetic susceptibility to multiple sclerosis in French patients
19156166 Observational study of gene-disease association. (HuGE Navigator)
18285833 IFIH1 interferon induced helicase, GCA grancalcin or the potassium channel KCNH7 - are potential candidates implicated in the pathogenesis of multiple sclerosis.
18285833 Observational study of gene-disease association. (HuGE Navigator)
18071670 The reported type 1 diabetes association is from a linkage disequilibrium region including three candidate genes, FAP, IFIH1 and GCA.
12804766 GCA interacts with SRI in vivo and in vitro.

AA Sequence

MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAVAGQDGEVDA      1 - 70
EELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVE     71 - 140
HHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDF    141 - 210
LQGTMAI                                                                   211 - 217
//

Text Mined References (26)

PMID Year Title
26648480 2016 Grancalcin (GCA) modulates Toll-like receptor 9 (TLR9) mediated signaling through its direct interaction with TLR9.
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19156166 2009 IFIH1-GCA-KCNH7 locus is not associated with genetic susceptibility to multiple sclerosis in French patients.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18285833 2008 IFIH1-GCA-KCNH7 locus: influence on multiple sclerosis risk.
18071670 2008 The association between the IFIH1 locus and type 1 diabetes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12804766 2003 The PEF family proteins sorcin and grancalcin interact in vivo and in vitro.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11717497 2001 Structure of Ca(2+)-loaded human grancalcin.
11279160 2001 Biochemical characterization of the penta-EF-hand protein grancalcin and identification of L-plastin as a binding partner.
10903868 2000 Crystal structure of human grancalcin, a member of the penta-EF-hand protein family.
9441591 1997 A growing family of the Ca2+-binding proteins with five EF-hand motifs.
1737748 1992 Molecular cloning and characterization of grancalcin, a novel EF-hand calcium-binding protein abundant in neutrophils and monocytes.
1530588 1992 Isolation and characterization of grancalcin, a novel 28 kDa EF-hand calcium-binding protein from human neutrophils.