Property Summary

NCBI Gene PubMed Count 28
PubMed Score 25.51
PubTator Score 12.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid Arthritis 1.100 3.4e-03
astrocytic glioma -1.500 8.3e-03
oligodendroglioma -1.800 1.8e-14
esophageal adenocarcinoma -1.300 1.8e-02
psoriasis -1.700 8.3e-04
glioblastoma -2.200 9.5e-07
ependymoma -1.600 6.8e-06
sonic hedgehog group medulloblastoma -3.900 2.1e-09
atypical teratoid / rhabdoid tumor -3.400 3.5e-09
medulloblastoma, large-cell -3.700 2.5e-07
primitive neuroectodermal tumor -2.700 7.9e-05
tuberculosis and treatment for 6 months -1.200 8.1e-03
non-small cell lung cancer -1.179 1.1e-09
intraductal papillary-mucinous adenoma (... -1.400 3.9e-02
intraductal papillary-mucinous carcinoma... -1.500 6.8e-04
intraductal papillary-mucinous neoplasm ... -2.000 3.4e-02
colon cancer -2.200 2.9e-02
lung cancer -3.900 6.1e-07
pediatric high grade glioma -2.000 7.1e-06
pilocytic astrocytoma -2.100 2.7e-05
subependymal giant cell astrocytoma -3.180 8.9e-03
invasive ductal carcinoma -2.100 3.2e-04
breast carcinoma -1.400 1.4e-19
Pick disease -1.200 1.8e-02
gastric carcinoma 1.400 4.1e-02
ductal carcinoma in situ -1.100 3.8e-02
ovarian cancer 1.900 2.0e-05

Gene RIF (15)

PMID Text
26506240 Low GAS7C increases cancer cell motility by promoting N-WASP/FAK/F-actin cytoskeleton dynamics. It also enhances beta-catenin stability via hnRNP U/beta-TrCP complex formation.
24151073 We conclude that lower neuronal Gas7b levels may impact Alzheimer disease progression.
22662195 These findings indicate that Gas7 is involved in motor neuron function associated with muscle strength maintenance.
22570627 Intraocular pressure (IOP)was significantly associated with rs11656696, located in GAS7 at 17p13.1 and with rs7555523, located in TMCO1 at 1q24.1.These data suggest that we have identified two clinically relevant genes involved in IOP regulation.
22496485 The results suggest that regulation to maintain an appropriate concentration of hGas7b is required for healthy neurotransmission.
21452305 regulates the differentiation of mesenchymal stem cells into osteoblasts by enhancing Runx2-dependent gene expression
20890993 Knockdown of Gas7 by shRNA preferentially suppressed the Gas7b protein isoform in human preneuronal cells and to reduce apoptosis induced either by serum starvation or by the antineoplastic agents in human neuroblastoma SH-SY5Y cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19861958 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19801671 hGas7b has a role in microtubular maintenance and is possibly implicated in Alzheimer disease
15948147 This work reports the identification of two human Gas7 cDNA: hGas7-a with 2,427 nucleotides, which encodes 330 amino acids, and hGas7-b with 2,610 nucleotides, which encodes 412 amino acids according to predicted open-reading-frames.

AA Sequence

MSGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGWFPASYVQLLEKPGMVPPPP      1 - 70
GEESQTVILPPGWQSYLSPQGRRYYVNTTTNETTWERPSSSPGIPASPGSHRSSLPPTVNGYHASGTPAH     71 - 140
PPETAHMSVRKSTGDSQNLGSSSPSKKQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKD    141 - 210
PQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKK    211 - 280
SLADEAEVHLKFSAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDL    281 - 350
EMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELERLEVERVEMIR    351 - 420
QHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGNIRPVDMEI                  421 - 476
//

Text Mined References (31)

PMID Year Title
26506240 2015 Growth-arrest-specific 7C protein inhibits tumor metastasis via the N-WASP/FAK/F-actin and hnRNP U/?-TrCP/?-catenin pathways in lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25173106 2014 Genome-wide analysis of multi-ancestry cohorts identifies new loci influencing intraocular pressure and susceptibility to glaucoma.
24151073 2013 Gas7b (growth arrest specific protein 7b) regulates neuronal cell morphology by enhancing microtubule and actin filament assembly.
24002674 2014 Genome-wide association study and meta-analysis of intraocular pressure.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
22662195 2012 Gas7-deficient mouse reveals roles in motor function and muscle fiber composition during aging.
22570627 2012 Common genetic determinants of intraocular pressure and primary open-angle glaucoma.
22496485 2012 Alzheimer's disease-related protein hGas7b interferes with kinesin motility.
21452305 2011 Gas7 mediates the differentiation of human bone marrow-derived mesenchymal stem cells into functional osteoblasts by enhancing Runx2-dependent gene expression.
20890993 2010 Knockdown of growth-arrest-specific gene 7b (gas7b) using short-hairpin RNA desensitizes neuroblastoma cells to cisplatin: Implications for preventing apoptosis of neurons.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19861958 2010 Genetic analysis in a Dutch study sample identifies more ulcerative colitis susceptibility loci and shows their additive role in disease risk.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19801671 2009 A novel role for hGas7b in microtubular maintenance: possible implication in tau-associated pathology in Alzheimer disease.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15948147 2005 Human Gas7 isoforms homologous to mouse transcripts differentially induce neurite outgrowth.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11795944 2002 Association of the growth-arrest-specific protein Gas7 with F-actin induces reorganization of microfilaments and promotes membrane outgrowth.
10706619 2000 Detection of leukemia-associated MLL-GAS7 translocation early during chemotherapy with DNA topoisomerase II inhibitors.
9736752 1998 gas7: A gene expressed preferentially in growth-arrested fibroblasts and terminally differentiated Purkinje neurons affects neurite formation.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7626897 1995 Interspecies fluorescence in situ hybridization further defines synteny homology between mouse chromosome 11 and human chromosome 17.