Property Summary

NCBI Gene PubMed Count 129
PubMed Score 294.94
PubTator Score 235.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
psoriasis 2.000 5.9e-05
glioblastoma -1.100 1.6e-05
cystic fibrosis 1.520 3.7e-05
medulloblastoma, large-cell -2.000 3.0e-05
adrenocortical carcinoma -1.025 2.1e-03
primary pancreatic ductal adenocarcinoma 1.032 2.7e-02
non-small cell lung cancer -1.810 1.9e-19
intraductal papillary-mucinous adenoma (... -1.500 7.4e-03
intraductal papillary-mucinous carcinoma... -1.100 1.9e-02
intraductal papillary-mucinous neoplasm ... -1.300 5.2e-03
lung cancer -1.200 1.3e-03
pediatric high grade glioma -1.100 2.5e-04
group 3 medulloblastoma -1.600 3.7e-04
pilocytic astrocytoma -1.100 7.0e-06
lung adenocarcinoma -2.000 2.7e-10
lung carcinoma -1.900 2.9e-23
Breast cancer -1.300 6.2e-06
invasive ductal carcinoma -1.600 5.5e-04
ovarian cancer 3.500 3.3e-07

Protein-protein Interaction (2)

Gene RIF (110)

PMID Text
27006397 Gas6-mediated uptake is not a means to clear the bulk of circulating membrane-derived microparticles (PMPs) but may serve to locally phagocytose PMPs generated at sites of platelet activation and as a way to effect endothelial responses.
26445266 decreased plasma Gas6 concentration and labial salivary gland expression were associated with primary Sjogren syndrome(pSS); Gas6 may represent a novel independent risk factor for pSS, with a potential role in salivary gland inflammation and dysfunction
26415371 a protective role for AA Gas6 variant in type 2 diabetic patients may be concluded
26350366 High expression of Gas6 correlated with Upper Tract Urothelial Carcinoma.
26284522 Gas6 gene variants are associated with IR, although their effects on subsequent progression to T2D were minimal in this prospective Asian cohort
26207647 Gas6 increases the metastatic capacity of oral squamous cell carcinoma(OSCC) cells and serum Gas6 could be a candidate biomarker for diagnostic and prognostic use in OSCC patients.
26206560 Gas6-induced Axl signaling is a critical driver of pancreatic cancer progression.
25957430 Data shoed increased GAS6 and decreased MGP levels in hemodialysis patients, as mediators of induction or prevention of vascular calcification.
25908269 Gas6 and Axl serum levels increase in parallel to chronic liver disease progression inactivation.
25869052 GAS6 intron 8 c.834 + 7G > A polymorphism was not associated with diabetic nephropathy in type 2 diabetes mellitus. However, heterozygous state of this polymorphism may be a risk factor for diabetic retinopathy in patients with diabetic nephropathy.
25752901 Suggest an association between low plasma GAS6 levels and conventional cardiometabolic risk factors in psoriasis.
25703520 genetic variability of GAS6 and PEAR1 genes may be associated with platelet hyperaggregability
25187556 HIF-1 and HIF-2 directly activate the expression of AXL and GAS6/AXL signaling uses lateral activation of the met proto-oncogene (MET) through SRC proto-oncogene nonreceptor tyrosine kinase to maximize cellular invasion.
25102945 Inhibition of the Gas6 receptor Mer or therapeutic targeting of Gas6 by warfarin is a promising strategy for the treatment of multiple myeloma.
24939420 Macrophages can be reprogrammed by Gas6 to promote epithelial proliferation and wound repair.
24899617 Plasma levels of growth arrest specific protein 6 are increased in idiopathic recurrent pregnancy loss
24789534 GAS6 protein promotes the proliferation and migration of endothelial progenitor cells through the PI3K/AKT signaling pathway.
24770797 Gas6 could play a potential role in the pathogenesis of adult-onset Still's disease
24676757 These results suggest that plasma Gas6 is associated with sex hormones in both pre- and postmenopausal women
24572151 The Gas6/Axl signaling pathway is involved in high glucose induced endothelial dysfunction.
24567414 Higher expression of Gas6/Axl pathway components in the LIMA compared with that in the aorta may partly explain the less frequent atherosclerotic events involving the LIMA compared with other arteries.
24512357 plasma levels associated with albuminuria in patients with type 2 diabetes
24476104 Gas6 significantly enhanced the number of myelin basic protein-positive (MBP+) oligodendrocytes with membranous processes parallel with and ensheathing axons
24468100 Plasma Gas6 is associated with obesity, insulin sensitivity, inflammation, and endothelial dysfunction in women and may be a general marker of inflammatory conditions in women.
24409287 Gas6 stimulates angiogenesis of human retinal endothelial cells and of zebrafish embryos via ERK1/2 signaling.
24354620 caveolin-1-enriched microdomains have a role in Gas6-induced tissue factor expression in endothelial cells
24326683 High GAS6 expression is associated with acute myeloid leukemia.
24276640 High gas6 acivity is associated with oral cancer progression.
24236135 Plasma concentrations predict aortic expression of growth-arrest-specific protein 6 in patients undergoing coronary artery bypass grafting.
24233839 findings indicate that Gas6/Axl regulates tumor invasion through the transcriptional activation of Slug
24178067 Serum Gas6 level is increased in SLE patients with lupus nephritis or cutaneous vasculitis, implicating a potential to serve as a SLE disease activity marker.
23979857 GAS6-AS1 expression served as an independent predictor for overall survival.
23878800 Our data propose GAS6 as an independent predictor of poor survival, suggesting GAS6, both on the mRNA and on the protein level, as a potential biomarker for ovarian cancer.
23826128 Gas6 was uniquely upregulated in either endothelial/mesangial cells or podocytes in IgA nephropathy.
23781120 CSF concentration of Gas6 is inversely correlated with the severity of relapse in RR-MS patients but does not predict the subsequent course of the disease.
23684948 The expression of TAM receptor tyrosine kinases and their ligand Gas6 is markedly downregulated in psoriatic epidermis. This downregulated gene expression is present in both uninvolved and involved epidermal samples.
23684620 Axl activated by Gas6 could protect osteosarcoma cells from apoptosis caused by serum starvation, and promote tumor cells' migration and invasion in vitro.
23570341 In melanoma cell lines, Gas6 induced Tyro3 phosphorylation and downstream Akt phosphorylation without apparent effects on Erk
23567973 Gas6 induces activation of JNK and ERK1/2 signaling in cancer cells expressing Axl, resulting in phosphorylation of activator protein (AP)-1 transcription factors c-Jun and ATF-2 and induction of Slug.
23497733 The present study highlights that the GAS6/ProS-TAM system correlates in several ways with disease activity in systemic lupus erythematosus
23430954 Gas6 enhanced the proliferation of colorectal cancer cells and suppressed the activation of macrophages in vitro.
23419144 No difference in allelic and genotype frequency of the rs8191974 polymorphism in the GAS6 gene was found in a case-control study of patients with acute myocardial infarction.
23354874 Gas6, a ligand of Tyro3, exerts an autocrine activities though Tyro3 and Axl in a subgroup of leiomyosarcoma.
23341490 Circulating Gas6 levels are strongly associated with adiposity, inflammation, and insulin resistance status among overweight and obese adolescents.
23318499 maternal Gas6 serum concentrations are significantly increased in pre-eclampsia during pregnancy. Furthermore, the adipokines leptin and adiponectin are independent predictors of circulating Gas6 in pregnant women
23318455 Data indicate that Gas6/Axl-mediated proliferation of schwannoma cells depends on NF-kappa B p65.
23242819 High expression of Gas6 is associated with lung adenocarcinoma.
23209669 Gas6 c.834+7G>A polymorphism in exudative AMD development; there are genetic interactions between CFH, HTRA1 and C3 polymorphisms that might contribute to the pathogenesis of dry age-related macular degeneration
22914895 It is not clear why Gas6 levels are elevated in systemic lupus erythematosus patients. It may be a secondary increase due to inflammatory conditions or a contributing factor to the pathogenesis of the disease.
22907951 Dysregulation of circulating Gas6 is associated with renal disease and inversely proportional to renal function.
22833165 The Axl receptor shedding is an active process affected and influenced by the Gas6-mediated Axl-signaling in systemic lupus erythematosus and Behcets disease.
22763415 Genetic polymorphism of the growth arrest-specific 6 gene is associated with cutaneous vasculitis in Taiwanese patients with systemic lupus erythematosus.
22516347 Data show that growth arrest-specific 6 (GAS6) and receptor tyrosine kinase Axl is colocalize with hypoxia-inducible factor-1alpha (Hif-1alpha) in both primary tumors and bone metastasis in prostate tumor tissue microarrays samples.
22363695 The present study explores Mer behavior following prolonged exposure to Gas6.
22072012 Gas6 acts as a protective factor, in part by reducing the pro-inflammatory phenotype of vascular smooth muscle cells
21959217 The Gas6 c.843+7AA genotype and A allele are less prevalent in type 2 diabetes, which may have a protective role for type 2 diabetes.
21638224 Among patients with VTE, mean gas6 levels showed a trend of higher levels in those with more extensive thrombi.
21501828 Gas6 mediates binding of the virus to target cells by bridging virion envelope phosphatidylserine to Axl
21343401 Our findings suggest that a TYRO3/AXL-GAS6 autocrine circuit sustains the malignant features of thyroid cancer cells
21278074 plasma concentrations of Gas6 and sAxl vary with disease activity in Systemic Lupus Erythematosus, and may have a role in lupus pathogenesis.
21067537 Vitamin K-dependent GAS6 synthesis is likely to be a regulatory mechanism during systemic inflammation, rather than the result of GAS6 interacting with bacteria or other infectious agents during sepsis.
20922806 This study showed that Gas6 and Axl are frequently overexpressed in PDA cells and are associated with a poor prognosis in patients with stage II PDA. Axl promotes the invasion and survival of PDA cells.
20664904 No association of the variants in GAS6 gene and carotid atherosclerosis was observed.
20664904 Observational study of gene-disease association. (HuGE Navigator)
20546121 Gas6 and Tyro3, Axl and Mer (TAM) receptors have roles in human and murine platelet activation and thrombus stabilization
20504897 Plasma Gas6 is associated with altered glucose tolerance, inflammation, and endothelial dysfunction.
20417630 Gas6 and soluble Axl have a role in critical limb ischemia, presumably connected to the inflammatory process
20126470 activation of GAS6 receptors on prostate cancer in the bone marrow environment may play a critical role as a molecular switch, establishing metastatic tumor cell dormancy.
20103767 GAS6 modulates macrophage cytokine secretion, triggering an "anti-inflammatory pathway" involving PI3K/Akt/GSK3 beta and NF-kappaB.
20088931 Gas6 in circulation is bound to sAxl suggesting circulating Gas6 to be inhibited and incapable of stimulating the TAM receptors.
20048160 These results indicate that androgen receptor signaling directly regulates Gas6 transcription, which leads to inhibition of vascular calcification, and provides a mechanistic insight into the cardioprotective action of androgens.
19965679 These findings highlight a novel role for Gas6 in a positive amplification loop, whereby tumors promote their growth by educating infiltrating leukocytes to up-regulate the production of the mitogen Gas6.
19922767 data suggest that growth arrest-specific-6 (GAS6)/MER receptor tyrosine kinase axis regulates homing and survival of the E2A/PBX1-positive B-cell precursor acute lymphoblastic leukemia in the bone marrow niche
19888345 Axl and its ligand Gas6, the vitamin-K dependent protein product of the growth arrest-specific gene 6, have a role in progression of clear cell RCC (ccRCC) derived cells
19744001 Plasma concentration of growth arrest-specific protein 6 is increased in patients with acute pancreatitis.
19696043 Data do not support the idea that Gas6 protein and Gas6 polymorphisms may be associated with thrombosis in sticky platelet syndrome.
19696043 Observational study of gene-disease association. (HuGE Navigator)
19657094 Gas6/Axl-mediated signaling regulates human dendritic cell (DC) activities; this study identifies Gas6/Axl as a new DC chemotaxis pathway.
19567592 Data show that Axl and Gas6 expression in RCC are associated with tumor advancement and patient survival.
19369636 GAS6 plasma concentrations at admission reflect the presence of common cardiovascular risk factors and can predict cardiovascular events.
19369636 Observational study of gene-disease association. (HuGE Navigator)
19132213 Found no association between plasma Gas6 levels and coronary artery disease.
18840707 The Axl/Gas6 pathway contributes to normal human NK-cell development via an effect on the master regulatory transcription factor T-BET.
18760998 The experiments described in this paper propose a novel functional role of gamma-carboxylation in gas6-mediated endothelial cell survival.
18680538 gas6 protects endothelial cells from apoptosis by a mechanism that involves PI3K-Akt-dependent inactivation of FOXO1a.
18570189 These findings identify a role for Gas6 in plaque composition and stability.
18395422 Gas6-promoted phagocytosis was inhibited by L-type Ca(2+)-channel blockage, which in turn may be activated by integrin receptor stimulation.
18174285 adiponectin antagonizes the stimulatory effect of TNFalpha on vascular calcification by restoration of the AMPK-dependent Gas6-mediated survival pathway.
18172262 Axl and Gas6 are frequently overexpressed in both glioma and vascular cells and predict poor prognosis in GBM patients
17897008 GAS6 signals via its receptor tyrosine kinases and plays a key role in the perpetuation of platelet aggregates and clot retraction.
17721624 Observational study of gene-disease association. (HuGE Navigator)
17721624 the CACA haplotype, is less prevalent in patients with stroke
16999853 Gas6 has a role in aspirin resistance
16723520 We conclude that gas6 signaling through the Axl receptor and the PI3 kinase/Akt1 survival pathway protects oligodendrocytes from growth factor withdrawal and TNFalpha-mediated cell death.
16556867 Restoration of Gas6 mRNA by statins was mediated by mRNA stabilization, and not by an increase in transcriptional activity.
16362042 The crystal structure at 3.3 A resolution of a minimal human Gas6/Axl complex reveals an assembly of 2:2 stoichiometry.
15958209 This report demonstrates that Gas6-induced downregulation of Axl is blocked by inhibitors of endocytosis and lysosomal degradation, but not by inhibitors of proteosomal activity.
15605394 Axl overexpression and activation by Gas6 could be involved in progression of prostate neoplastic disease
15507525 Axl stimulation by GAS6 results in inhibition of the ligand-dependent activation of vascular endothelial growth factor (VEGF) receptor 2 and the consequent activation of an angiogenic program in vascular endothelial cells
15452374 Gas6/Axl pathway could play a role in the complex events taking place during the early changes of ovarian cancer progression.
15130893 New information about the mechanism underlying Gas6 protection from apoptosis in primary endothelial cell cultures.
15108283 Observational study of gene-disease association. (HuGE Navigator)
15108283 GAS6 intron-exon structure, identification of single nucleotide polymorphisms and possible association with stroke.
14750094 GAS6/Axl signaling is involved in human renal disease.
12768229 Gas6, acting as a growth factor, is increased in the process of kidney allograft dysfunction and in chronic allograft nephropathy.
12764109 Gas6 sustains fetal oligodendrocyte viability by receptor activation and downstream signaling via the phosphatidylinositol 3-kinase-dependent/ proto-oncogene protein akt pathway.
12490074 Axl and Gas6 expression might be involved in childhood thyroid tumorigenesis around Chernobyl.
12218057 GAS6 has a V-shaped arrangement of laminin G-like LG domains strengthened by an interdomain calcium-binding site
12029073 Data suggest that Gas6 and Axl signal transduction is aberrantly stimulated in endometriotic endometria, and is plausibly related to its growth potential.
11175853 Gas6-deficient mice are protected against thrombosis, indicating that a physiological function of Gas6 is that of a procoagulant. This effect is mediated, at least in part, through platelets, as Gas6-deficient platelets are less prone to aggregation.

AA Sequence

MAPSLSPGPAALRRAPQLLLLLLAAECALAALLPAREATQFLRPRQRRAFQVFEEAKQGHLERECVEELC      1 - 70
SREEAREVFENDPETDYFYPRYLDCINKYGSPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNF     71 - 140
FCLCKAGWGGRLCDKDVNECSQENGGCLQICHNKPGSFHCSCHSGFELSSDGRTCQDIDECADSEACGEA    141 - 210
RCKNLPGSYSCLCDEGFAYSSQEKACRDVDECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCELE    211 - 280
AGWPCPRHRRDGSPAARPGRGAQGSRSEGHIPDRRGPRPWQDILPCVPFSVAKSVKSLYLGRMFSGTPVI    281 - 350
RLRFKRLQPTRLVAEFDFRTFDPEGILLFAGGHQDSTWIVLALRAGRLELQLRYNGVGRVTSSGPVINHG    351 - 420
MWQTISVEELARNLVIKVNRDAVMKIAVAGDLFQPERGLYHLNLTVGGIPFHEKDLVQPINPRLDGCMRS    421 - 490
WNWLNGEDTTIQETVKVNTRMQCFSVTERGSFYPGSGFAFYSLDYMRTPLDVGTESTWEVEVVAHIRPAA    491 - 560
DTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEAT    561 - 630
LEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRLLDLDE    631 - 700
AAYKHSDITAHSCPPVEPAAA                                                     701 - 721
//

Text Mined References (134)

PMID Year Title
27006397 2016 The Gas6-Axl Protein Interaction Mediates Endothelial Uptake of Platelet Microparticles.
26445266 2015 Growth Arrest-Specific 6 Protein in Patients with Sjögren Syndrome: Determination of the Plasma Level and Expression in the Labial Salivary Gland.
26415371 2015 Serum Level of Growth Arrest-Specific 6 (Gas6) Protein and Genetic Variations in the Gas6 Gene in Patients with Type 2 Diabetes Mellitus.
26350366 2016 Relationship Between Increased Expression of the Axl/Gas6 Signal Cascade and Prognosis of Patients with Upper Tract Urothelial Carcinoma.
26284522 2015 Effect of Common Genetic Variants of Growth Arrest-Specific 6 Gene on Insulin Resistance, Obesity and Type 2 Diabetes in an Asian Population.
26207647 2015 Elevated Serum Gas6 Is a Novel Prognostic Biomarker in Patients with Oral Squamous Cell Carcinoma.
26206560 2015 Warfarin Blocks Gas6-Mediated Axl Activation Required for Pancreatic Cancer Epithelial Plasticity and Metastasis.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25957430 2015 Growth Arrest-specific 6 Protein and Matrix Gla Protein in Hemodialysis Patients.
25908269 2015 Gas6/Axl pathway is activated in chronic liver disease and its targeting reduces fibrosis via hepatic stellate cell inactivation.
25869052 2015 GAS6 intron 8 c.834 + 7G > A gene polymorphism in diabetic nephropathy.
25752901 2015 Growth arrest-specific 6 and cardiometabolic risk factors in patients with psoriasis.
25703520 2015 Different models of inheritance in selected genes in patients with sticky platelet syndrome and fetal loss.
25187556 2014 Direct regulation of GAS6/AXL signaling by HIF promotes renal metastasis through SRC and MET.
25102945 2015 Role of Growth arrest-specific gene 6-Mer axis in multiple myeloma.
24939420 2014 RhoA/phosphatidylinositol 3-kinase/protein kinase B/mitogen-activated protein kinase signaling after growth arrest-specific protein 6/mer receptor tyrosine kinase engagement promotes epithelial cell growth and wound repair via upregulation of hepatocyte growth factor in macrophages.
24899617 2014 Plasma levels of growth arrest specific protein 6 are increased in idiopathic recurrent pregnancy loss.
24789534 2014 Growth arrest-specific gene 6 protein promotes the proliferation and migration of endothelial progenitor cells through the PI3K/AKT signaling pathway.
24770797 2014 Serum growth arrest-specific protein 6 levels are elevated in adult-onset Still's disease.
24676757 2014 Plasma growth arrest-specific protein 6 levels in premenopausal and postmenopausal women: the role of endogenous estrogen.
24572151 2014 High glucose induces human endothelial dysfunction through an Axl-dependent mechanism.
24567414 2014 Expression of growth arrest-specific protein 6 and Axl molecules in the left internal mammary artery of patients undergoing coronary artery bypass grafting.
24512357 2014 Association of plasma growth arrest-specific protein 6 (Gas6) concentrations with albuminuria in patients with type 2 diabetes.
24476104 2014 Gas6 enhances axonal ensheathment by MBP+ membranous processes in human DRG/OL promyelinating co-cultures.
24468100 2014 The levels of plasma growth arrest-specific protein 6 is associated with insulin sensitivity and inflammation in women.
24409287 2014 Gas6 stimulates angiogenesis of human retinal endothelial cells and of zebrafish embryos via ERK1/2 signaling.
24354620 2014 Gas6-induced tissue factor expression in endothelial cells is mediated through caveolin-1-enriched microdomains.
24326683 2014 GAS6 expression identifies high-risk adult AML patients: potential implications for therapy.
24276640 2014 Tumor-associated macrophages promote oral cancer progression through activation of the Axl signaling pathway.
24236135 2013 Plasma concentrations predict aortic expression of growth-arrest-specific protein 6 in patients undergoing coronary artery bypass grafting.
24233839 2014 Gas6/Axl pathway promotes tumor invasion through the transcriptional activation of Slug in hepatocellular carcinoma.
24178067 2014 Elevated serum level of growth arrest-specific protein 6 (Gas6) in systemic lupus erythematosus patients is associated with nephritis and cutaneous vasculitis.
23979857 2013 Low expression of long noncoding RNA GAS6-AS1 predicts a poor prognosis in patients with NSCLC.
23878800 2013 Meta-analysis of microarray data identifies GAS6 expression as an independent predictor of poor survival in ovarian cancer.
23826128 2013 Dual involvement of growth arrest-specific gene 6 in the early phase of human IgA nephropathy.
23781120 2013 Growth arrest specific gene 6 protein concentration in cerebrospinal fluid correlates with relapse severity in multiple sclerosis.
23684948 2013 The expression of TAM receptors and their ligand Gas6 is downregulated in psoriasis.
23684620 2013 Gas6/Axl mediates tumor cell apoptosis, migration and invasion and predicts the clinical outcome of osteosarcoma patients.
23570341 2013 Evaluation of Tyro3 expression, Gas6-mediated Akt phosphorylation, and the impact of anti-Tyro3 antibodies in melanoma cell lines.
23567973 2013 Gas6 induces cancer cell migration and epithelial-mesenchymal transition through upregulation of MAPK and Slug.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23497733 2013 Vitamin K-dependent proteins GAS6 and Protein S and TAM receptors in patients of systemic lupus erythematosus: correlation with common genetic variants and disease activity.
23430954 2013 Inhibitory role of Gas6 in intestinal tumorigenesis.
23419144 2013 AA genotype of single-nucleotide polymorphism c.834+7G>A in GAS6 gene (rs8191974) is not protective for acute myocardial infarction.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23354874 2013 Autocrine role for Gas6 with Tyro3 and Axl in leiomyosarcomas.
23341490 2013 Circulating growth arrest-specific 6 protein is associated with adiposity, systemic inflammation, and insulin resistance among overweight and obese adolescents.
23318499 2013 Serum levels of growth arrest specific protein 6 are increased in preeclampsia.
23318455 2014 Axl/Gas6/NF?B signalling in schwannoma pathological proliferation, adhesion and survival.
23242819 2013 Higher expression of receptor tyrosine kinase Axl, and differential expression of its ligand, Gas6, predict poor survival in lung adenocarcinoma patients.
23209669 2012 Effect of the Gas6 c.834+7G>A polymorphism and the interaction of known risk factors on AMD pathogenesis in Hungarian patients.
23084921 2012 The TIM and TAM families of phosphatidylserine receptors mediate dengue virus entry.
22914895 2013 Serum growth arrest-specific protein 6 levels are a reliable biomarker of disease activity in systemic lupus erythematosus.
22907951 2012 Growth arrest-specific gene 6 (Gas6) levels are elevated in patients with chronic renal failure.
22833165 2012 Plasma concentrations of growth arrest specific protein 6 and the soluble form of its tyrosine kinase receptor Axl in patients with systemic lupus erythematosus and Behçets disease.
22763415 2012 Genetic polymorphism of the growth arrest-specific 6 gene is associated with cutaneous vasculitis in Taiwanese patients with systemic lupus erythematosus.
22516727 2012 Growth arrest-specific gene 6 (gas6) and vascular hemostasis.
22516347 2012 Hypoxia stabilizes GAS6/Axl signaling in metastatic prostate cancer.
22363695 2012 Prolonged exposure to a Mer ligand in leukemia: Gas6 favors expression of a partial Mer glycoform and reveals a novel role for Mer in the nucleus.
22072012 2012 Increased secretion of Gas6 by smooth muscle cells in human atherosclerotic carotid plaques.
21959217 2012 The growth arrest-specific 6 (Gas6) gene polymorphism c.834+7G>A is associated with type 2 diabetes.
21638224 2011 Elevated plasma gas6 levels are associated with venous thromboembolic disease.
21501828 2011 The soluble serum protein Gas6 bridges virion envelope phosphatidylserine to the TAM receptor tyrosine kinase Axl to mediate viral entry.
21343401 2011 Activation of TYRO3/AXL tyrosine kinase receptors in thyroid cancer.
21278074 2011 Plasma concentrations of Gas6 and sAxl correlate with disease activity in systemic lupus erythematosus.
21067537 2010 GAS6 in systemic inflammatory diseases: with and without infection.
20922806 2011 Overexpression of receptor tyrosine kinase Axl promotes tumor cell invasion and survival in pancreatic ductal adenocarcinoma.
20664904 2010 Association study between polymorphims in GAS6-TAM genes and carotid atherosclerosis.
20546121 2010 Potentiating role of Gas6 and Tyro3, Axl and Mer (TAM) receptors in human and murine platelet activation and thrombus stabilization.
20504897 2010 Plasma protein growth arrest-specific 6 levels are associated with altered glucose tolerance, inflammation, and endothelial dysfunction.
20417630 2010 Plasma concentrations of Gas6 and soluble Axl correlate with disease and predict mortality in patients with critical limb ischemia.
20126470 2010 GAS6/AXL axis regulates prostate cancer invasion, proliferation, and survival in the bone marrow niche.
20103767 2010 TNF-alpha, IL-6, and IL-1 expression is inhibited by GAS6 in monocytes/macrophages.
20088931 2010 Gas6 is complexed to the soluble tyrosine kinase receptor Axl in human blood.
20048160 2010 Androgen receptor-dependent transactivation of growth arrest-specific gene 6 mediates inhibitory effects of testosterone on vascular calcification.
19965679 2010 Malignant cells fuel tumor growth by educating infiltrating leukocytes to produce the mitogen Gas6.
19922767 2010 GAS6/Mer axis regulates the homing and survival of the E2A/PBX1-positive B-cell precursor acute lymphoblastic leukemia in the bone marrow niche.
19888345 2009 Gas6 and the receptor tyrosine kinase Axl in clear cell renal cell carcinoma.
19744001 2009 Plasma concentrations of growth arrest-specific protein 6 and protein S in patients with acute pancreatitis.
19696043 2010 Is Gas6 protein associated with sticky platelet syndrome?
19657094 2009 Survival and migration of human dendritic cells are regulated by an IFN-alpha-inducible Axl/Gas6 pathway.
19567592 2009 Differential expression of Axl and Gas6 in renal cell carcinoma reflecting tumor advancement and survival.
19369636 2009 Plasma level of growth arrest-specific 6 (GAS6) protein and genetic variations in the GAS6 gene in patients with acute coronary syndrome.
19132213 2009 Plasma Gas6 levels and coronary artery disease.
18840707 2009 The Axl/Gas6 pathway is required for optimal cytokine signaling during human natural killer cell development.
18760998 2008 Gas6-mediated signaling is dependent on the engagement of its gamma-carboxyglutamic acid domain with phosphatidylserine.
18680538 2008 GAS6-induced signaling in human endothelial cells is mediated by FOXO1a.
18570189 2008 Genetic loss of Gas6 induces plaque stability in experimental atherosclerosis.
18395422 2008 Endogenous Gas6 and Ca2+ -channel activation modulate phagocytosis by retinal pigment epithelium.
18174285 2008 Adiponectin antagonizes stimulatory effect of tumor necrosis factor-alpha on vascular smooth muscle cell calcification: regulation of growth arrest-specific gene 6-mediated survival pathway by adenosine 5'-monophosphate-activated protein kinase.
18172262 2008 Axl and growth arrest-specific gene 6 are frequently overexpressed in human gliomas and predict poor prognosis in patients with glioblastoma multiforme.
17897008 2007 Growth arrest specific gene (GAS) 6 modulates platelet thrombus formation and vascular wall homeostasis and represents an attractive drug target.
17721624 2007 Association of specific haplotypes of GAS6 gene with stroke.
17005688 2006 Tyro3 family-mediated cell entry of Ebola and Marburg viruses.
16999853 2006 Plasma levels of the growth arrest-specific gene 6 product (Gas6) and antiplatelet drug responsiveness in healthy subjects.
16723520 2006 Gas6/Axl signaling activates the phosphatidylinositol 3-kinase/Akt1 survival pathway to protect oligodendrocytes from tumor necrosis factor alpha-induced apoptosis.
16564713 Role of the growth arrest-specific gene 6 (gas6) product in thrombus stabilization.
16556867 2006 Statins protect human aortic smooth muscle cells from inorganic phosphate-induced calcification by restoring Gas6-Axl survival pathway.
16362042 2006 Structural basis for Gas6-Axl signalling.
16359517 2005 The role of gamma-carboxylation in the anti-apoptotic function of gas6.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15958209 2005 Effects of Gas6 and hydrogen peroxide in Axl ubiquitination and downregulation.
15605394 2005 Gas6 induces proliferation in prostate carcinoma cell lines expressing the Axl receptor.
15507525 2005 Inhibition of vascular endothelial growth factor receptor 2-mediated endothelial cell activation by Axl tyrosine kinase receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15452374 2004 Coexpression of Gas6/Axl in human ovarian cancers.
15184064 2004 Vitamin K-dependent Gas6 activates ERK kinase and stimulates growth of cardiac fibroblasts.
15130893 2004 Intracellular signaling pathways involved in Gas6-Axl-mediated survival of endothelial cells.
15108283 2004 Human vitamin K-dependent GAS6: gene structure, allelic variation, and association with stroke.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14750094 2004 Growth arrest specific protein 6/Axl signaling in human inflammatory renal diseases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12768229 2003 Expression of growth arrest-specific gene 6 and its receptors in dysfunctional human renal allografts.
12764109 2003 The growth arrest-specific gene product Gas6 promotes the survival of human oligodendrocytes via a phosphatidylinositol 3-kinase-dependent pathway.
12490074 2002 Expression of receptor-type tyrosine kinase, Axl, and its ligand, Gas6, in pediatric thyroid carcinomas around chernobyl.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12364394 2002 Acidification prevents endothelial cell apoptosis by Axl activation.
12218057 2002 Crystal structure of a C-terminal fragment of growth arrest-specific protein Gas6. Receptor tyrosine kinase activation by laminin G-like domains.
12029073 2002 Coexpression of growth arrest-specific gene 6 and receptor tyrosine kinases, Axl and Sky, in human uterine endometrium and ovarian endometriosis.
11175853 2001 Deficiency or inhibition of Gas6 causes platelet dysfunction and protects mice against thrombosis.
10954847 2000 Expression of the receptor protein-tyrosine kinases Tyro-3, Axl, and mer in the developing rat central nervous system.
9367994 1997 Cell adhesion to phosphatidylserine mediated by a product of growth arrest-specific gene 6.
9326369 1997 The product of a gas6 splice variant allows the release of the domain responsible for Axl tyrosine kinase receptor activation.
9326368 1997 Identification and tissue expression of a splice variant for the growth arrest-specific gene gas6.
9259426 1997 Human chondrocyte expression of growth-arrest-specific gene 6 and the tyrosine kinase receptor axl: potential role in autocrine signaling in cartilage.
8939948 1996 Identification of the product of growth arrest-specific gene 6 as a common ligand for Axl, Sky, and Mer receptor tyrosine kinases.
8637702 1996 Gas6, the ligand of Axl tyrosine kinase receptor, has mitogenic and survival activities for serum starved NIH3T3 fibroblasts.
8621659 1996 Characterization of Gas6, a member of the superfamily of G domain-containing proteins, as a ligand for Rse and Axl.
8604045 1996 Identification of Gas6 as a growth factor for human Schwann cells.
8595896 1995 Assignment of the human GAS6 gene to chromosome 13q34 by fluorescence in situ hybridization.
8336730 1993 The protein encoded by a growth arrest-specific gene (gas6) is a new member of the vitamin K-dependent proteins related to protein S, a negative coregulator in the blood coagulation cascade.
7867073 1995 The anticoagulation factor protein S and its relative, Gas6, are ligands for the Tyro 3/Axl family of receptor tyrosine kinases.
7854420 1995 Axl receptor tyrosine kinase stimulated by the vitamin K-dependent protein encoded by growth-arrest-specific gene 6.
7634325 1995 Reevaluation of the roles of protein S and Gas6 as ligands for the receptor tyrosine kinase Rse/Tyro 3.