Property Summary

Ligand Count 50
NCBI Gene PubMed Count 37
PubMed Score 181.22
PubTator Score 102.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (28)

Disease log2 FC p
acute quadriplegic myopathy 1.626 1.0e-10
adult high grade glioma 1.100 3.8e-03
astrocytic glioma 2.200 4.7e-03
Astrocytoma, Pilocytic 1.100 8.8e-06
atypical teratoid / rhabdoid tumor 1.300 2.5e-07
Breast cancer 2.800 4.0e-02
colon cancer 1.400 2.1e-02
ependymoma 2.400 1.9e-02
Gaucher disease type 1 -1.300 8.3e-03
glioblastoma 1.400 1.7e-07
group 3 medulloblastoma 1.600 6.1e-06
hepatocellular carcinoma 1.100 3.6e-05
intraductal papillary-mucinous carcinoma... 1.200 5.8e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.8e-02
lung adenocarcinoma 1.600 4.4e-20
lung cancer 1.700 2.6e-04
malignant mesothelioma 1.200 3.0e-06
medulloblastoma, large-cell 1.400 4.5e-05
nasopharyngeal carcinoma 1.100 4.3e-04
non-small cell lung cancer 1.285 3.5e-16
oligodendroglioma 1.100 7.6e-03
osteosarcoma 1.785 6.6e-05
ovarian cancer -1.900 1.1e-09
pancreatic cancer 1.600 9.6e-03
primary pancreatic ductal adenocarcinoma 1.884 3.2e-03
primitive neuroectodermal tumor 1.100 3.2e-04
psoriasis 1.100 7.8e-04
tuberculosis -1.200 1.6e-04

PDB (29)

Gene RIF (20)

AA Sequence

MAARVLIIGSGGREHTLAWKLAQSHHVKQVLVAPGNAGTACSEKISNTAISISDHTALAQFCKEKKIEFV      1 - 70
VVGPEAPLAAGIVGNLRSAGVQCFGPTAEAAQLESSKRFAKEFMDRHGIPTAQWKAFTKPEEACSFILSA     71 - 140
DFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIMQEKAFGAAGETIVIEELLDGEEVSCLCFTDGKTVA    141 - 210
PMPPAQDHKRLLEGDGGPNTGGMGAYCPAPQVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLT    211 - 280
KNGPKVLEFNCRFGDPECQVILPLLKSDLYEVIQSTLDGLLCTSLPVWLENHTALTVVMASKGYPGDYTK    281 - 350
GVEITGFPEAQALGLEVFHAGTALKNGKVVTHGGRVLAVTAIRENLISALEEAKKGLAAIKFEGAIYRKD    351 - 420
VGFRAIAFLQQPRSLTYKESGVDIAAGNMLVKKIQPLAKATSRSGCKVDLGGFAGLFDLKAAGFKDPLLA    421 - 490
SGTDGVGTKLKIAQLCNKHDTIGQDLVAMCVNDILAQGAEPLFFLDYFSCGKLDLSVTEAVVAGIAKACG    491 - 560
KAGCALLGGETAEMPDMYPPGEYDLAGFAVGAMERDQKLPHLERITEGDVVVGIASSGLHSNGFSLVRKI    561 - 630
VAKSSLQYSSPAPDGCGDQTLGDLLLTPTRIYSHSLLPVLRSGHVKAFAHITGGGLLENIPRVLPEKLGV    631 - 700
DLDAQTWRIPRVFSWLQQEGHLSEEEMARTFNCGVGAVLVVSKEQTEQILRDIQQHKEEAWVIGSVVARA    701 - 770
EGSPRVKVKNLIESMQINGSVLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIV    771 - 840
ISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGK    841 - 910
MLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAE    911 - 980
HKIFPAALQLVASGTVQLGENGKICWVKEE                                            981 - 1010
//

Text Mined References (43)

PMID Year Title