Property Summary

NCBI Gene PubMed Count 35
PubMed Score 53.65
PubTator Score 27.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Synonym

Accession O14556 B2RC82 O60823 Q6JTT9 Q9HCU6
Symbols GAPD2
GAPDS
HSD-35
GAPDH-2
HEL-S-278

Gene

PANTHER Protein Class (2)

PDB

3H9E   3PFW   5C7L   5C7O  

  Ortholog (2)

Protein-protein Interaction (6)

Gene RIF (17)

PMID Text
26660717 This result implies that GAPDHS participates in specific signal-transduction pathways.
25936797 Structural basis for the NAD binding cooperativity and catalytic characteristics of sperm-specific glyceraldehyde-3-phosphate dehydrogenase
23675907 Data indicate that the positive expression of studied genes fertilization rate for GAPDHS positive subset was 66%, ACR - 71%, SPATA22 - 68%, MND1 - 70%, pregnancy rates were 8%, 6%, 18% and 36% respectively.
23306140 GAPDS protein was expressed in both Sertoli cells and elongated sperms. The expression of GAPDS gradually increased with age in the epididymis.
23026046 the expression of GAPDS in melanoma cells may facilitate glycolysis and prevent the induction of apoptosis.
21995946 The chaperonin TRiC was shown to assist an ATP-dependent refolding of recombinant forms of GAPDS.
21269272 Structure and kinetic characterization of human sperm-specific glyceraldehyde-3-phosphate dehydrogenase, GAPDS.
20880607 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20833277 Data suggest that high stability of the sperm-specific GAPDS is of importance for the efficiency of fertilization.
20828617 Human his-GAPDHS expressed in baculovirus-infected insect cells is homotetrameric.
20534741 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18298375 Comparative study of the amino acid sequences of mammalian GAPDs revealed conservative cysteine residues (C21, C94, and C150) that are specific for the sperm isoenzyme and absent in the somatic isoenzyme.
17192785 Meta-analysis of gene-disease association. (HuGE Navigator)
16832079 Observational study of gene-disease association. (HuGE Navigator)
16700075 Characterization of the rat GAPDHS and comparison to the human and mouse enzymes.
16324157 We have concluded that a simple nuclear localization of GAPDH does not induce apoptosis, and that MPP+-induced apoptosis is not caused by nuclear translocation of GAPDH.
10714828 GAPD2 enzymatic activity is present in human sperm. GAPD2 is tightly bound to sperm and most enzymatic activity is not released by permeabilization with CHAPS detergent. GAPD2 is restricted in location to the principal piece of the sperm flagellum.

AA Sequence

MSKRDIVLTNVTVVQLLRQPCPVTRAPPPPEPKAEVEPQPQPEPTPVREEIKPPPPPLPPHPATPPPKMV      1 - 70
SVARELTVGINGFGRIGRLVLRACMEKGVKVVAVNDPFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVV     71 - 140
DNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVISAPSPDAPMFVMGVNEND    141 - 210
YNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIP    211 - 280
ASTGAAKAVTKVIPELKGKLTGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTE    281 - 350
DEVVSTDFLGDTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRDK                351 - 408
//

Text Mined References (36)

PMID Year Title
26660717 2016 The proline-rich region of glyceraldehyde-3-phosphate dehydrogenase from human sperm may bind SH3 domains, as revealed by a bioinformatic study of low-complexity protein segments.
25936797 2015 Structural basis for the NAD binding cooperativity and catalytic characteristics of sperm-specific glyceraldehyde-3-phosphate dehydrogenase.
23675907 2013 Expression analysis of MND1/GAJ, SPATA22, GAPDHS and ACR genes in testicular biopsies from non-obstructive azoospermia (NOA) patients.
23306140 2013 Location and characterization of GAPDS in male reproduction.
23026046 2012 Sperm-specific glyceraldehyde-3-phosphate dehydrogenase is expressed in melanoma cells.
21995946 2011 Chaperonin TRiC assists the refolding of sperm-specific glyceraldehyde-3-phosphate dehydrogenase.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269272 2011 Structure and kinetic characterization of human sperm-specific glyceraldehyde-3-phosphate dehydrogenase, GAPDS.
20880607 2012 Exploration of 16 candidate genes identifies the association of IDE with Alzheimer's disease in Han Chinese.
20833277 2010 Recombinant human sperm-specific glyceraldehyde-3-phosphate dehydrogenase: structural basis for enhanced stability.
20828617 2011 Recombinant human sperm-specific glyceraldehyde-3-phosphate dehydrogenase (GAPDHS) is expressed at high yield as an active homotetramer in baculovirus-infected insect cells.
20534741 2010 Association of CR1, CLU and PICALM with Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
18298375 2008 Investigation of glyceraldehyde-3-phosphate dehydrogenase from human sperms.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17192785 2007 Systematic meta-analyses of Alzheimer disease genetic association studies: the AlzGene database.
17047026 2006 Non-invasive genetic diagnosis of male infertility using spermatozoal RNA: KLHL10 mutations in oligozoospermic patients impair homodimerization.
16832079 2006 Exploring the association of glyceraldehyde-3-phosphate dehydrogenase gene and Alzheimer disease.
16820410 2006 Novel function of beta-arrestin2 in the nucleus of mature spermatozoa.
16700075 2006 Expression of the spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase (GAPDS) in rat testis.
16324157 2005 Nuclear localization of glyceraldehyde-3-phosphate dehydrogenase is not involved in the initiation of apoptosis induced by 1-Methyl-4-phenyl-pyridium iodide (MPP+).
15507493 2004 Association of late-onset Alzheimer's disease with genetic variation in multiple members of the GAPD gene family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11330647 Susceptibility of glycolytic enzyme activity and motility of spermatozoa from rat, mouse, and human to inhibition by proven and putative chlorinated antifertility compounds in vitro.
11225901 1999 Approaches to post-testicular contraception.
10714828 Human glyceraldehyde 3-phosphate dehydrogenase-2 gene is expressed specifically in spermatogenic cells.
10655454 2000 L-type voltage-dependent calcium channel alpha-1C subunit mRNA is present in ejaculated human spermatozoa.
9264469 1997 Glyceraldehyde 3-phosphate dehydrogenase is bound to the fibrous sheath of mammalian spermatozoa.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7144574 1982 Glyceraldehyde-3-phosphate dehydrogenase from human tissues.
4349855 1973 Effects of (H + ), (Na + ), (K + ) and certain membrane-active drugs on glycolysis, motility, and ATP synthesis by human spermatozoa.
3170585 1988 Isolation and complete sequence of a functional human glyceraldehyde-3-phosphate dehydrogenase gene.
2793178 1989 Members of the human glyceraldehyde-3-phosphate dehydrogenase-related gene family map to dispersed chromosomal locations.