Property Summary

NCBI Gene PubMed Count 28
PubMed Score 92.17
PubTator Score 92.26

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (13)

Protein-protein Interaction (1)

Gene RIF (15)

AA Sequence

MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFG      1 - 70
MAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLS     71 - 140
EETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTE    141 - 210
VMALVPPADCRYYAFPQMITPLVTKG                                                211 - 236
//

Text Mined References (38)

PMID Year Title