Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.54
PubTator Score 3.20

Knowledge Summary


No data available


  Differential Expression (16)

 MGI Phenotype (1)

Gene RIF (2)

25813380 Two identified candidate O-glycoprotein biomarkers (CD44 and GalNAc-T5) circulating with the STn glycoform were further validated as being expressed in gastric cancer tissue
24619076 of GalNAc-T5 expression in gastric cancer tissues might add some prognostic information for patients with this disease and lead to a more accurate classification under the TNM stage system

AA Sequence

GNFSQKILKVAACDPVKPYQKWKFEKYYEA                                            911 - 940

Text Mined References (10)

PMID Year Title
25813380 2015 Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.
24619076 2014 Clinical significance of polypeptide N-acetylgalactosaminyl transferase-5 (GalNAc-T5) expression in patients with gastric cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10545594 1999 A direct interaction between EXT proteins and glycosyltransferases is defective in hereditary multiple exostoses.