Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.68
PubTator Score 11.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
aldosterone-producing adenoma -1.182 4.7e-03
astrocytic glioma 1.300 2.4e-02
Astrocytoma, Pilocytic 1.600 9.2e-08
atypical teratoid / rhabdoid tumor 2.400 2.7e-04
Barrett's esophagus 1.200 3.2e-02
ependymoma 1.200 4.3e-05
esophageal adenocarcinoma 1.300 2.1e-02
glioblastoma 1.900 1.2e-04
group 4 medulloblastoma -1.200 3.2e-03
interstitial cystitis 1.100 1.8e-02
intraductal papillary-mucinous adenoma (... 2.100 5.2e-04
intraductal papillary-mucinous carcinoma... 1.100 3.7e-02
lung adenocarcinoma 1.090 3.5e-04
osteosarcoma -2.114 7.6e-04
ovarian cancer -1.900 5.1e-06
pediatric high grade glioma 1.500 6.3e-05
subependymal giant cell astrocytoma 2.028 2.0e-02

 MGI Phenotype (1)

Gene RIF (8)

AA Sequence

MRRKEKRLLQAVALVLAALVLLPNVGLWALYRERQPDGTPGGSGAAVAPAAGQGSHSRQKKTFFLGDGQK      1 - 70
LKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRY     71 - 140
LETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILR    141 - 210
TKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQA    211 - 280
GDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEIS    281 - 350
FKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDV    351 - 420
AVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVR    421 - 490
GRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVS    491 - 560
GSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN                               561 - 603
//

Text Mined References (19)

PMID Year Title